SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005967 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005967
Domain Number 1 Region: 593-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 649-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 818-875
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 541-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 762-819
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 860-912
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-20
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 706-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-18
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 31-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000262
Family KRAB domain (Kruppel-associated box) 0.0049
Further Details:      
 
Domain Number 9 Region: 248-369
Classification Level Classification E-value
Superfamily SET domain 0.0000392
Family Viral histone H3 Lysine 27 Methyltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005967   Gene: ENSBTAG00000004538   Transcript: ENSBTAT00000005967
Sequence length 920
Comment pep:known chromosome:UMD3.1:1:45065846:45078993:1 gene:ENSBTAG00000004538 transcript:ENSBTAT00000005967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPMAMRPNTSPEESTERDAGRTEWKPTAKDAFKDISVYFSKEEWEEMGEWEKIRYRNVKR
NYEALIAIGFRATRPAFMHHRRQVIKLQADDTEDSDEEWTPRQQGKLSSMAFRVEHNKHQ
NKTMSRAPLSKEFSLKELPGAAKLLKTSGSKQAQKLVPPPGKARTPGQHPRQKVELRRKE
TEVKRYSLRERKGHVYQEVSEPQDDDYLYCEECQSFFIDSCAAHGPPIFVKDCAVEKGHA
NRSALTLPPGLSIRESSIPEAGLGVWNEVSDLPLGLHFGPYEGQITDDEEAANSGYSWLI
TKRRNCYEYVDGKDTSLANWMRYVNCARDDEEQNLVALQYHGQIFYRTCQVVRPGCELLV
WYGDEYGQDLGIKRESSRKSELAGPRAESKPKIHPCASCSLAFSSQKFLSQHVQHNHPSQ
TLLRPSARDYLQPEDPCPGSQNQQQRYSDPHSPSDKPEGREVKDRPQPLLKSIRLKRISR
ASSYSPRGQMGASGVHERITEEPSTSQKPNPEDTGKLFMGAGVSGIIKVKYGECGQGSKD
RSSLITNQRTHTGEKPYVCGECGQSFNQKSTLITHQRTHTGEKPYVCGECGRSFNQKSTL
ITHQRTHTGEKPYVCGECGRSFSQKSTLIKHQRTHTGEKPYVCGECGQSFNQKSTLITHQ
RTHTGEKPYVCGECGQSFNQKSTLITHQRTHTGEKPYVCGECGRSFSRKSTLITKHERTH
FGEKPYGCHLCGKTFSKTSYLRQHERTHNGEKPYGCHLCGKAFTHCSHLRKHERTHTGEK
PYECHLCGKAFTESSVLRRHERTHTGEKPYECHLCWKAFTDSSVLKRHERTHTGEKPYEC
HLCGKTFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHKRIHTGEKPYKCYLCG
KAFSKYFNLRQHERTHAIKV
Download sequence
Identical sequences E1BNW2
ENSBTAP00000005967 ENSBTAP00000002795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]