SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006022 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006022
Domain Number 1 Region: 201-348
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.39e-42
Family Dual specificity phosphatase-like 0.000000204
Further Details:      
 
Domain Number 2 Region: 3-149
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.17e-32
Family Cell cycle control phosphatase, catalytic domain 0.000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006022   Gene: ENSBTAG00000004587   Transcript: ENSBTAT00000006022
Sequence length 381
Comment pep:known chromosome:UMD3.1:5:19276348:19280028:-1 gene:ENSBTAG00000004587 transcript:ENSBTAT00000006022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGSLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPTQ
QLYFTTPSNQNVYQVDSLQST
Download sequence
Identical sequences L8HXJ4 Q2KJ36
ENSBTAP00000006022 9913.ENSBTAP00000006022 NP_001039660.1.59421 NP_001039660.1.76553 XP_005906390.1.15283 XP_010803074.1.76553 XP_010830356.1.44457 XP_014337143.1.15283 XP_015326381.1.76553 XP_019815885.1.53367 ENSBTAP00000006022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]