SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006103 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006103
Domain Number 1 Region: 34-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000337
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 222-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000723
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 740-763,1038-1065
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000014
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 4 Region: 310-331,481-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000154
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000006103
Domain Number - Region: 150-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000535
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006103   Gene: ENSBTAG00000004650   Transcript: ENSBTAT00000006103
Sequence length 1108
Comment pep:known chromosome:UMD3.1:24:2858679:2910274:1 gene:ENSBTAG00000004650 transcript:ENSBTAT00000006103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSREAEAELRGGRSPSRASRSPEADGDRALSHSCCICGKTFPFQSSLSQHMRKHTGEK
PYKCPYCDHRAAQKGNLKIHIRGHRAGTLTQGREPEAAETRVSEGLGGCTSPTKSTSACN
RILNGATQADTGKILLRSTRKEAEGVAAGQCAFCKSRFERKKDLAQHVQQAHKPFTCRLC
SYATLREEALLSHVEKDHIAAQGPRGDAFAENGKPELPPGEFPCEVCGQAFSQTWFLKAH
MKKHRGSFDHGCHICGRRFKEPWFLKNHMKAHGPKAGSKNRPRSELEPVATINDVVQEEV
IVAGLSLYEVCTKCGNLFTNLDSLNAHNAIHRRVEAGQPRAAVGEGSAPGPADSQQFFLQ
CLNLRPAAGTPTRGQTGRRVAELDPVNSYQAWQLATRGKVAEPAEYLKYAAWDEALAGDV
AFDKERREFILVSQEKRKREPEPGAQGPPRKRAGAPGDPAPGPPDPRPAARPSRRAAVPA
GHGKSSECFECGKIFRTYHQMVLHSRVHRRARRDRERDGPGDRAPRARCGSLSEGDSASQ
PSSPGSGCAAADSPGSGLADEAADESGEEAPAHPTAGAKPHRCCFPEDVSLTVLSNGDQS
HTLGNSPSGRAAGEPGAGIAACVSILESSSRDAPRRPEPPRCSVDLKTPACGPQQEGPGP
RDAADLPPRPAQAAGLQPPSESQAAYPRERPPDLHTKEHPTAGKQAPAPDLVPLDLSERS
SRDDPGRREPASSLQAALAVHPCPYCGHKTYYPEVLWMHKRVWHRVSGQAVAPQWTQPNG
YKSIRSNLVFLARSGRTGPPPALGGKECQPLPIARFTRTQVPGGAPGPKGSPSPLGVPTK
AAGLPRSKEGHPGAPCTLWTAGPDGTRQTRPGPSPEQPPPKPKQEASPRPGATGGSGGFS
RSATPTPTVITRAGPQAPASGRQGAGLGPPSKHSAPDPPKAKFSPQPQGQPHGKGDGATP
LPPREPPSKAGSRGPAVPQGPPAPHPVKQEPASEGPEKRLDLLSIFKTYIPKDLASLYQS
WGASSPVLERRGTLRTQAHQGDFICVECGKSFHQPSHLRAHMRAHTVLFESNGLRGADAH
TTSADTPKQGRDHSNADAVQTVPLRKGT
Download sequence
Identical sequences E1BCA0
XP_002697699.2.76553 XP_597668.4.59421 ENSBTAP00000006103 9913.ENSBTAP00000006103 ENSBTAP00000006103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]