SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006133 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006133
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-36
Family SCAN domain 0.0000555
Further Details:      
 
Domain Number 2 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 450-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 373-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000232
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 189-220
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000811
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006133   Gene: ENSBTAG00000004675   Transcript: ENSBTAT00000006133
Sequence length 513
Comment pep:known chromosome:UMD3.1:19:31251615:31262941:-1 gene:ENSBTAG00000004675 transcript:ENSBTAT00000006133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PETARQLFRQFPYQVMSGPHETLQQLRKLCFQWLQPEVHTKEQILEMLMLEQFLSILPGE
IQTWVRKQCPGSGEEAVTLVESLKGDPQRLWQWISIQVLGQEVFSEKAEPASCPAGDAGS
PAEEPQKLGLQNTAPGPGEPLSCVVKEESDMEQGLAAAATQLSAQLPAQPEQMPVRDQDF
RASLLHTASQEQWRHLDSTQKEQYWDLMLETYGKMVSGGAGISSARPDLTDPAGYGVELA
GPHLQANEKIPRPTCIGDRGENDKENLNLENYRAQDPPALGEPPPQAPLSGLFSEDEPRP
FGEGEDLSEAQGNLRGEGTGGQLCPQERNSRKQPGPHLLPPLPGDSPAPWPEEKREAALR
GQPRAPMAQRLPTCRECGKTFYRNSQLVFHQRTHSRETYFQCPTCQKAFLRSSSFMKHQR
IHTGEKPCKCDYCGKGFSDFSGLRYHKKIHTGEKPYKCPVCEKSFIQRSNFNRHQRVHTG
EKPYKCTRCGKSFSWSSSLDKHQRSHLGKKPRP
Download sequence
Identical sequences F1MJI9
ENSBTAP00000006133 ENSBTAP00000006133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]