SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006171 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006171
Domain Number 1 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.12e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.25e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 240-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-20
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 7 Region: 103-144
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000387
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006171   Gene: ENSBTAG00000015866   Transcript: ENSBTAT00000006171
Sequence length 507
Comment pep:known chromosome:UMD3.1:18:65220784:65224810:-1 gene:ENSBTAG00000015866 transcript:ENSBTAT00000006171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGVRTLENPRQGSVTFEDVAVYFSWEEWALLDEAQRCLYHDVMLENFALTSSLGYWHGVE
DKEAPSEQSICIGVSQIRTLKVDSSPHKGQPFEMCGPVLRDILHFPEHQETHLGQKPYTC
GNRFYISANLQQYQEQHIGEIPIRSSVDTALIINSCTTHVSGKPTVYGEIGNDFLVNVGF
FHHTEEKPNNSNECEAVSHNGKRHENWGEGNKALNCTDTLVEDQRVLTREGLYECSKCTR
RCNLIQHQKVHTGERPYECHECGKLFTYLSSFIIHQRVHSGERPYECSECGKSFSQSYSL
NSHRKVHTGEKPYECRECGKSFSQRSNLIQHQRVHTGERPYECSECGKSFSQNFSLIYHR
RVHTGERPHQCSECGKSFSRSSSLIHHRRLHTGERPYECSKCGKSFKQSSSFSSHRKVHT
GERPYECGDCGKSFSHSSNLKNHWRVHTGERPVECSECGKSFSCKSNLVKHLRVHTGERP
YECVECGKSFSQSSSLIQHQRVHIGKR
Download sequence
Identical sequences F1MK14
ENSBTAP00000006171 9913.ENSBTAP00000006171 ENSBTAP00000006171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]