SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006213 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006213
Domain Number 1 Region: 32-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.62e-92
Family Calponin-homology domain, CH-domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-33
Family Spectrin repeat 0.0000925
Further Details:      
 
Domain Number 3 Region: 2179-2298
Classification Level Classification E-value
Superfamily PH domain-like 2.63e-33
Family Pleckstrin-homology domain (PH domain) 0.0000168
Further Details:      
 
Domain Number 4 Region: 1644-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 8.88e-30
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 1854-2009
Classification Level Classification E-value
Superfamily Spectrin repeat 5.83e-27
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 1014-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 2.82e-26
Family Spectrin repeat 0.00000527
Further Details:      
 
Domain Number 7 Region: 819-954
Classification Level Classification E-value
Superfamily Spectrin repeat 1.55e-24
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 8 Region: 642-745
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-24
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 9 Region: 1536-1679
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-24
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 10 Region: 1232-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-23
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 11 Region: 429-533
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-22
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 12 Region: 749-853
Classification Level Classification E-value
Superfamily Spectrin repeat 3.68e-20
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 13 Region: 526-647
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-18
Family Spectrin repeat 0.00081
Further Details:      
 
Domain Number 14 Region: 2015-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000104
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 15 Region: 1355-1466
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000124
Family Spectrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006213   Gene: ENSBTAG00000004732   Transcript: ENSBTAT00000006213
Sequence length 2335
Comment pep:known chromosome:UMD3.1:10:77201411:77273590:-1 gene:ENSBTAG00000004732 transcript:ENSBTAT00000006213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPADMTSATEFENVGNQPPYSRINARWDGPDDELDNDNSSARLFERSRIKALADEREVVQ
KKTFTKWANSHLVHVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENV
DKALQFLREQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAK
DALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEH
AFEVAERELGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDH
AIETEKMIEKYSGLASDLLTWIEQTITILNSRKFANSLAGVQQQLQAFSTYRTVEKPPKF
QEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRDELIR
QEKLEQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEE
RVRALEDLAQELERENYHDQKRIMARKDNILRLWDYLQELLQARRQRLEKTLDLQKLFQD
MLHSIDWMDGIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITTATLQFTE
GPGYQPCDPQVIQDRVSHLEQCFEELSNTAAGRKAQLEQSKQLCKFFWEMDEAESWIKEK
EQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLDQIFREAEGMVARKQFGHERIEV
RIKKVSDQWNELKDLAAFCKKNLQDTENFFQFQGDADDLKAWLQDAHRLLSGEDVGHDEG
ATRALGKKHKDFLEELEESRGVMEHLEQQAQAFPQGFQDSPDVTNRLQALRDLYQQVVAQ
ADMRQQRLQDALDLYTVFGETDACELWMGEKGKWLAQMEIPDTLEDLEVVQHRFDILDQE
MKTLMTQIDGVNLAANSLVESNHPRSAEVKKYQDRLNTRWQDFQTMVSERREAVDSALRV
HNYCVDCEETGKWIADKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQARLGTLER
ESQQLMASHPELKEDIEQRQAYVEELWQGLMQALKSQEASLGEASQLQAFLQDLDAFQAW
LSTTQKDVASKDMPESLPEAEQLLQQHAAIKDDIDRHQESYQKVRVSGEKVTHGQTDPEY
LLLGQRLDGLEKGWDALSRMWESRSQALTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEP
PDSLEAAEAGIRKFEDFLLSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRH
RKNNEKAQEASDLLKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQ
AFVAELASHQGWLENIDAEGKQLMEEKPQFAVLVSQKLEALHQLWDELQANTQEMAQHLS
AARSSDLRSQTQADLNKWIRAMEDQLQSDDLGKDLTSVNRMLAKLKRVEDQVNVRKEELQ
ELFAQMPSLGEEAGDEALSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEE
RLPLAQSTDYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLHRGQQLVAAAEIDCQDVE
ERLGKLQGSWDTLQEAAASRLQHLREASEAQQYYLDAGEAEAWIGEQEFYVFSDENPQDE
ESAIVMLKRHLRQQRAVDEYGRNIKQLAGRAQGLLSAGHPEGEQIIRLQGQVDKQYAGLK
DMAEERRRKLENMYHLFQLKREVDDLEQWITEKDTVASSSEMGQDFDHVTVLRDKFRDFA
RETGAIGQERVDNVNAIIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAAS
YDLQRYFYTSSEILGLIGEKHRELPEDVGLDASTAESFHRTHTAFERELHLLGEQVQQFQ
DVAARLQTAYAGEKADIIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLL
SWMESIVRQIETQEKPRDVSSVELLMKYHQGIQAEIETRSKNFSTCLELGESLLQRQHQA
SEEIREKREQVVSRREEMQEKWEARWERLRMLLEVCQFFRDASVAEAWLIAQEPYLASRD
YGHTVDSVEKLIKRHEAFEKSAASWEGRFAALEKPTTLELKERQTPERTEEEPGLQEEEG
ETAGEAPRGPHQATTERTSPGEEERPWPQDLQPPPPPGPHEDGQEEKSSTDERPATEPLF
KVLDTPLSEGDEPTTLPAQRDRGHSVQMEGFLGRKHDLEGPNKKASNRSWNNLYCVLRNS
ELAFYKDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDE
EEMLSWLQGVSTAINESQSIRVKAQSLPLPPITGPEASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences F1MKE9
ENSBTAP00000006213 ENSBTAP00000006213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]