SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006274 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006274
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-35
Family Dual specificity phosphatase-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006274   Gene: ENSBTAG00000004776   Transcript: ENSBTAT00000006274
Sequence length 150
Comment pep:known chromosome:UMD3.1:3:10029474:10030882:-1 gene:ENSBTAG00000004776 transcript:ENSBTAT00000006274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQPPNFSWVLPRRLAGLALPRLPAHYQFLLDQGVRHLVSLTERGPPHSDSCPGLTLHR
LRIPDFCPPGPEQIDRFVKIVDEANARGEAVAVHCALGFGRTGTMLACYLVKERGLAAGD
AIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Download sequence
Identical sequences A3KN00 L8HNT1
NP_001076078.1.59421 NP_001076078.1.76553 XP_005910506.1.15283 XP_010845162.1.44457 XP_010845163.1.44457 9913.ENSBTAP00000006274 ENSBTAP00000006274 ENSBTAP00000006274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]