SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006397 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006397
Domain Number 1 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-26
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-25
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 362-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 175-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000166
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006397   Gene: ENSBTAG00000031686   Transcript: ENSBTAT00000006397
Sequence length 419
Comment pep:known chromosome:UMD3.1:18:47237081:47266289:1 gene:ENSBTAG00000031686 transcript:ENSBTAT00000006397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQESVMFSDVSIDFSQEEWEFLNDDQRDLYRDVMLENYSNLVSMGHSISKPDVISFLEQ
GKEPWLVDRELTRDQWPVLESRCETKKLFLKKEIYEIESAQWELMDRLTRHDLQCSSFRD
EWECNGQFEKQHGSQEGHFSQLIFTHEGMPTFSQHPSFTLQQIMNNNKEKYCATKEYRKT
FRHDSQLTTHQIIHTVEKPYECKECGKAFRHPSRLSHHQKIHSGKKPFECKECGKTFICG
SDLTRHHRIHTGEKPYECKECGKAFSSGSNFARHQRIHTGEKPYECKECGKAFSSGSNFT
QHQRIHTGEKPYECKICGNAFSQSSQLIKHQRIHTGEKPYECKECEKAFRSGSDLTRHQR
IHTGEKPYECKICGKAYSQSSQLTSHHRIHTSEKAYEYRECAKTFNYDSQLVQHQNLYW
Download sequence
Identical sequences Q2KJ67
ENSBTAP00000006397 ENSBTAP00000006397 NP_001070485.1.59421 NP_001070485.1.76553 XP_010847387.1.44457 XP_019834650.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]