SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006896 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006896
Domain Number 1 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 6-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-24
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 5 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-24
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 6 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-19
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 9 Region: 616-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 10 Region: 202-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006896   Gene: ENSBTAG00000005240   Transcript: ENSBTAT00000006896
Sequence length 674
Comment pep:known chromosome:UMD3.1:17:44966897:44973509:-1 gene:ENSBTAG00000005240 transcript:ENSBTAT00000006896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPAKISFEDVAVNFTLEEWQLLNPTQKTLYRDVMLENYSNLVLLGYQVIKPEMIFKLEQ
ENPWLLDEEILSQNFSEKVWLDNNLKMWHQDNQDKLKSLERGHEYDIFERMFHLGINFDH
LGMRSHKCGTGEKSLKDPFDFLIPKSNCERKKLDELNRKLLFCIKPARTYGGIKYSDGNT
CRKVSSKEPGLIMSHIPHTGVCLCMECGKVFNKKSQLIIHQRTHTGEKPYGCRDCGKAFS
QKSLLTIHQRTHSGEKPYGCGECQKAFSRKSLLILHQRTHTGEKPYGCSDCGKAFSRKSQ
LKRHQITHTIEKPYGCSDCGKVFSQKLKLITHQRTHTGEKPYRCSDCGKAFFWKSQLITH
QRVHTGKKPYACSECKKAFSRNSLLIRHQRIHTGEKPYECSECGEAFIRKPQLVKHQMTH
TGEKNYQCSNCEEAFFKKSELIKHQKVHLGERPYGCVECGKTFFGKSQLLTHQRTHTGEK
PYECSACGKAFTQKSSLVSHQRTHTGEKPYECSECGKTFSEKSSLIHHQRTHTGEKPFEC
GECRKAFAWKPQLLRHQRIHTGEKPYGCSECGKAFVQKVQLIKHQRNHTGEKTYGCNDCA
KAFFEKAQLIIHQRIHTGERPYKCEECGKSFTRKSHLMRHQRIHTGDKYYGCSECGTVFH
RKAQLLIHQRSHML
Download sequence
Identical sequences E1BMX9
ENSBTAP00000006896 ENSBTAP00000006896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]