SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006968 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006968
Domain Number 1 Region: 286-458
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.44e-48
Family Cell cycle control phosphatase, catalytic domain 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006968   Gene: ENSBTAG00000005293   Transcript: ENSBTAT00000006968
Sequence length 477
Comment pep:known chromosome:UMD3.1:7:51313474:51344138:-1 gene:ENSBTAG00000005293 transcript:ENSBTAT00000006968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEFFSSKREEGSLASGPSFRSNQRKILNLLLERDASFSISSDLPTTPVEKKLFGDSAN
LSILSGGTPKRCLDLSNLSSGEMSATQLTASADLDETGHLESTGPEQVRLAGMNYRQHLI
KCSPAQLFCSTPNALEHGRRKKDAICGSSANKENDNGNLVENEMKHLGSPITTVSKLHKN
PELAEDQAEEISDELMEFSLEDQEKAKPPLNWSSLYRSSSLPDSLNSPSLKQVVKFKDST
IPDKLKKKYCSNQKELGKGLGLKKMVSLCDINMTQMLEEDSNQGPLIGDFSKVCALPTVS
GKHQDLKYVNPETVAALLSGEFQGLIEKFYIIDCRYPYEYLGGHIQGALNLHSQEELYNF
FLKKPIVPWDNQKRIVIVFHCEFSSERGPRMCRSLREEDRTLNQYPALYYPELYILKGGY
RDFFPEYMELCEPQSYCPMHHQDHKAELLRCRNQSKAWEGERQLQEQIALLVKDVSP
Download sequence
Identical sequences A5D7P0
ENSBTAP00000006968 ENSBTAP00000006968 9913.ENSBTAP00000006968 NP_001091465.1.59421 NP_001091465.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]