SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007159 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007159
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000642
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007159   Gene: ENSBTAG00000005441   Transcript: ENSBTAT00000007159
Sequence length 199
Comment pep:known chromosome:UMD3.1:7:53508799:53513894:1 gene:ENSBTAG00000005441 transcript:ENSBTAT00000007159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLES
KLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLD
QVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEED
DEMAAVMGFSGFGSTKKSY
Download sequence
Identical sequences A0A0D9RJM9 A0A1U7V3A8 A0A250YC37 A0A2K5DMY6 A0A2K5JSJ1 A0A2K5QD57 A0A2K5U498 A0A2K6A2P1 A0A2K6BU58 A0A2K6FVD2 A0A2K6KRR7 A0A2K6PL14 A0A2K6TG16 E2QZ35 F7CNZ5 F7GID5 F7INW3 G1LW72 G1SLE4 G3I598 G3QQY5 G3TL52 H0WJY0 H2PGT8 H2QRN0 I3LZM4 K9IYR2 M3VWD5 M3YAG3 Q0P584 Q96NC0 Q9CPW7 W5QBG7
ENSPTRP00000029620 ENSPTRP00000029620 ENSECAP00000012050 NP_001073812.1.59421 NP_001073812.1.76553 NP_001248696.1.72884 NP_079870.1.92730 NP_653324.1.87134 NP_653324.1.92137 XP_001140609.1.37143 XP_002710303.1.1745 XP_002744293.1.60252 XP_002816017.1.23681 XP_002912604.1.58354 XP_003404598.1.64505 XP_003510406.1.69978 XP_003782165.1.62490 XP_003829223.1.60992 XP_003933939.1.74449 XP_003980902.1.62641 XP_004008929.1.66739 XP_004042704.1.27298 XP_004280307.1.21590 XP_004381150.1.4749 XP_004397822.1.74151 XP_004477927.1.11602 XP_004643264.1.9945 XP_004686875.1.23501 XP_004744834.1.14098 XP_005327371.1.77405 XP_005382059.1.28644 XP_005558066.1.63531 XP_005683109.1.57651 XP_005983982.1.78601 XP_006062746.1.26621 XP_006156287.1.99106 XP_006172942.1.101512 XP_006731537.1.47382 XP_006866234.1.41390 XP_006923099.1.64745 XP_007077968.1.5354 XP_007108011.1.24612 XP_007194170.1.59432 XP_007461542.1.90284 XP_007629909.1.28591 XP_007937208.1.48129 XP_008012895.1.81039 XP_008072716.1.4292 XP_008583986.1.73410 XP_008689721.1.72690 XP_010386478.1.97406 XP_010612149.1.5607 XP_010848678.1.44457 XP_010970059.1.22495 XP_010989011.1.51371 XP_011714596.1.29376 XP_011795046.1.43180 XP_011820467.1.47321 XP_012005972.1.54773 XP_012323741.1.9421 XP_012516815.1.63892 XP_012604405.1.48125 XP_014919209.1.86478 XP_015340527.1.40921 XP_016021839.1.101085 XP_016069627.1.3490 XP_017387669.1.71028 XP_017747238.1.44346 XP_019279965.1.44245 XP_019518900.1.44202 XP_019595852.1.88060 XP_019780123.1.83887 XP_020012661.1.5219 XP_020736320.1.74333 XP_021070415.1.100879 XP_021507393.1.76796 XP_021557468.1.83697 XP_848938.1.84170 ENSPPYP00000017746 ENSAMEP00000011323 ENSFCAP00000001198 5o9z_N ENSPVAP00000009161 ENSCJAP00000029887 ENSP00000274712 ENSOCUP00000003679 ENSP00000274712 ENSOGAP00000001834 gi|21389511|ref|NP_653324.1| ENSOARP00000020064 ENSFCAP00000001198 ENSLAFP00000015594 ENSCAFP00000008845 ENSPVAP00000009161 ENSSTOP00000001799 ENSMPUP00000008320 ENSGGOP00000005015 ENSBTAP00000007159 ENSBTAP00000007159 ENSPCAP00000001487 ENSLAFP00000015594 ENSOCUP00000003679 ENSCAFP00000008845 ENSP00000274712 ENSECAP00000012050 ENSOGAP00000001834 ENSPPYP00000017746 ENSMPUP00000008320 ENSPCAP00000001487 ENSMUSP00000001419 ENSCJAP00000029887 ENSSTOP00000001799 ENSGGOP00000005015 ENSMUSP00000001419 10090.ENSMUSP00000001419 9598.ENSPTRP00000029620 9600.ENSPPYP00000017746 9606.ENSP00000274712 9615.ENSCAFP00000008845 9685.ENSFCAP00000001198 9796.ENSECAP00000012050 9913.ENSBTAP00000007159 9986.ENSOCUP00000003679 ENSMUSP00000001419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]