SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007182 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007182
Domain Number 1 Region: 180-293
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000173
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 
Domain Number 2 Region: 107-160
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000034
Family Ypt/Rab-GAP domain of gyp1p 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007182   Gene: ENSBTAG00000005458   Transcript: ENSBTAT00000007182
Sequence length 516
Comment pep:known chromosome:UMD3.1:25:1981117:2004112:1 gene:ENSBTAG00000005458 transcript:ENSBTAT00000007182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPPAYNCFVDRDKMDSAIPDLGPKELSCTELQELKQLARQGYWARSYALRGQVYQRLIR
DIPCRTVTPDASVYRDIVGKIVGKHSSASLPLPEFVDNTQVPSYCLNSKGEGAVRKILLC
ISNQFPDVSFCPALPAVVALLLHYSADEAECFEKACRILACNDSSRKLVDQSFLAFESSC
MTFGDLVNKYCQAAHKLMVAVSEDVLQVYADWQRWLFGELPLSYFARVFDVFLVEGYKVL
YRVALAILKFFHKVRAGQPLESDNVKQDIRAFVRDIAKTVSPEKLLEKAFAIRLFSRKEI
QLLQMANEKALKQKGITVKQKSVSLSKRQFVHLAVHADNFHSEIVGVKEMRDIWSWVPER
FALCQPLLLFSSLQHGYSLTRFYFQCEGREPTVLLIKTTQKEVCGAYLSTDWSERNKFGG
KLGFFGTGECFVFRLQPEVQRYEWVVIKHPELTKPAPLEPTTVPPSPSHSVSSEPADRLS
PFLATRHFNLPSKTESLFMAGGSDCLIIGHLAGRWR
Download sequence
Identical sequences F1N534
ENSBTAP00000007182 ENSBTAP00000007182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]