SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007216 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007216
Domain Number 1 Region: 287-343
Classification Level Classification E-value
Superfamily RING/U-box 2.42e-18
Family RING finger domain, C3HC4 0.00034
Further Details:      
 
Domain Number 2 Region: 133-220
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000103
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 206-275
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000148
Family IBR domain 0.031
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000007216
Domain Number - Region: 379-407
Classification Level Classification E-value
Superfamily DNA-binding domain of Mlu1-box binding protein MBP1 0.0811
Family DNA-binding domain of Mlu1-box binding protein MBP1 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007216   Gene: ENSBTAG00000005488   Transcript: ENSBTAT00000007216
Sequence length 491
Comment pep:known chromosome:UMD3.1:22:51572989:51610467:-1 gene:ENSBTAG00000005488 transcript:ENSBTAT00000007216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDMNSQGSDSNEEDYDPNCEEEEEDEDPGDIEDYYVGVASDVEQQGADSFDPEEYQFT
CLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVAEILDRYKSNSAQLLVEARV
QPNPSKHVPPAHSPHHCAVCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGVS
CMAQDCPLRTPEDFVFPLLPNEELRDKYRRYLFRDYVESHYQLQLCPGADCPMVIRVQEP
RARRVQCNRCNEVFCFKCRQMYHAPTDCATIRKWLTKCADDSETANYISAHTKDCPKCNI
CIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIVNQSQQAQAREAL
KKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKCRY
TLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQR
RRTLLKDFHDT
Download sequence
Identical sequences E1B8R6 L8HR99 W5Q383
ENSOARP00000017171 9913.ENSBTAP00000007216 ENSBTAP00000007216 NP_001193171.1.59421 NP_001193171.1.76553 XP_005222791.1.76553 XP_005222792.1.76553 XP_005909417.1.15283 XP_005909418.1.15283 XP_005969297.1.78601 XP_006053276.1.26621 XP_010850193.1.44457 XP_011955468.1.66739 XP_011977554.1.54773 XP_011977556.1.54773 XP_017922243.1.57651 XP_019840109.1.53367 ENSBTAP00000007216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]