SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007217 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007217
Domain Number 1 Region: 118-273
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000727
Family Polcalcin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007217   Gene: ENSBTAG00000005490   Transcript: ENSBTAT00000007217
Sequence length 494
Comment pep:known chromosome:UMD3.1:22:51556260:51569916:-1 gene:ENSBTAG00000005490 transcript:ENSBTAT00000007217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAGPRPEAPSPQWPPRHHDSAEAAARLSDCEDAPVRPLCKPRGICSRAYFLVLMVFV
HLYLGNVLALLLFVHYSNGDESSDPGPQRRAQGPGPAPTLAPLTRLEGIKVGHERKIQLV
ADRDHFIRTLSLKPLLFEIPGFLSDEECRLVIHLAQMKGLQRSQILPTEEYEEAMGTMQI
SPLDLFQLLDQNHDGRLQLREVLAQNRLGNGRWMTPETIQEMYSAIKADPDGDGVLSLQE
FSNMDLRDFHKYMRSHRAESSQLVRNSHHTWLYQGEGAHHVMRAIRQRVLRLTRLSPEIV
ELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNN
VTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPRQGTAVFWYNYLPDG
QGWVGDVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALFQQEMARLAREGGADSQPE
WALDRAYRDTRVEL
Download sequence
Identical sequences F1N3W9
ENSBTAP00000007217 ENSBTAP00000007217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]