SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007323 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007323
Domain Number 1 Region: 427-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.9e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 304-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-18
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 468-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 118-174
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000955
Family KRAB domain (Kruppel-associated box) 0.0039
Further Details:      
 
Domain Number 6 Region: 389-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000414
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007323   Gene: ENSBTAG00000005572   Transcript: ENSBTAT00000007323
Sequence length 550
Comment pep:known chromosome:UMD3.1:25:2556670:2565296:1 gene:ENSBTAG00000005572 transcript:ENSBTAT00000007323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADDGGIRAAQDKERARETPGHGHSCQEMLSESEGTVPLGEARESPHIKMEPEEPHPEG
VSQETRAEGARGWVPLSQGTKEKVCFLPGGALPAPQTPVLSREGRTRDRQMAAALLTAWS
QMPVTFEDMALYLSREEWGRLDHTQQSFYREVLQKRSGLSLGFPFSRPFWASQVQGKGEA
PGSSRQLGHEEEEKRGVVEVDKEELAASLGALGDAKSFKSRMGRAQGEAPRCGQRAASGQ
NSGPAKDDVQPCPVKEAQLESAPPDTDLPKTQEGHFPEQPREGGTAAPESSEEGLALDSE
AGKKTFKCEQCGKAFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTGEK
PYTCPSCWKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPHKC
PICGKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCG
KSFSHSSHLTAHQRTHRGVRPYSCPLCGKSFSRRSNLHRHEKIHTAGPKALAMLMLGAAG
TLAAPPPAPT
Download sequence
Identical sequences G3X6I8
XP_005224502.1.76553 ENSBTAP00000007323 ENSBTAP00000007323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]