SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007434 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007434
Domain Number 1 Region: 51-287
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-90
Family Calponin-homology domain, CH-domain 0.00000243
Further Details:      
 
Domain Number 2 Region: 2409-2527
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-31
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 304-424
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-30
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 1567-1722
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-28
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 5 Region: 433-535
Classification Level Classification E-value
Superfamily Spectrin repeat 9.72e-23
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 6 Region: 848-980
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-22
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 7 Region: 1888-2044
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-22
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 8 Region: 1780-1930
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-21
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 1252-1404
Classification Level Classification E-value
Superfamily Spectrin repeat 3.91e-20
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 10 Region: 528-648
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-18
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 11 Region: 1477-1591
Classification Level Classification E-value
Superfamily Spectrin repeat 2.63e-16
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 12 Region: 742-836
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 13 Region: 2014-2108
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-16
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 14 Region: 1085-1202
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000115
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 15 Region: 641-776
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000592
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 16 Region: 1412-1510
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000118
Family Spectrin repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000007434
Domain Number - Region: 998-1079
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0352
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007434   Gene: ENSBTAG00000004751   Transcript: ENSBTAT00000007434
Sequence length 2564
Comment pep:known chromosome:UMD3.1:18:50077666:50154685:1 gene:ENSBTAG00000004751 transcript:ENSBTAT00000007434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVPGEVDNMEGLPAPNNNNLSARWDSPDRGWEREQPAASTAAASLFECSRIKALADER
EAVQKKTFTKWVNSHLARVGCHIGDLYTDLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHS
LENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRET
RSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANY
NLQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGK
VLDQVLEVGKIIERYEELATELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEK
PVKFQEKGNLEVLLFSIQSKLRACNRRLYVPREGCGIWDIDKAWGQLEKAEHEREAALRA
ELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA
AYEERVQGVAELAQALATEGYYDARRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQK
VFQEMVYMVDWMEEMQAQLLSRECGQHLVEAEDLLQKHGLLEGDIAAQSERVEALNAAAL
RFSQLQGYQPCDPQVICNRVNHVHGCLAELQEQAARRRAELEASRSLWALLQELEEAESW
ARDKERLLEAAGGGGAAGATGAAGGAHDLSSTARLLAQHKILQGELGGRRALLQQALRRG
EELAAAGGAVGPGAETVHLAGLAERAASARRRWQRLEEAAARRERRLQEARALHQFGADL
DGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGPVGGLRRQLATLGGA
SGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGEKEQ
WLLAMRVPNSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQELVEGGHPSSDEVRSCQ
DHLNSRWNRIVELVEQRKEEVSAVLLVENHVLEVAEVRTQVREKRRAVESAPRAGGALQW
RLSGLEAALQALEPRQAALLEEAALLAVRFPAQAARLHQGAEELGAEWGALASAAQACGE
AVAAAGRLQRFLHDLDAFLDWLVRAQETAGGGEGPLPRSLEEADALLARHAALKEEVDQR
EEDYARIVAASEALLAGDGAELGPGLALDEWLPHLELGWHKLLGLWEARREALVQAHVYQ
LFLRDLRQARAVLRNQEMALSGQELPGTVESVEEALKRHRDFLTTMELNQQKMQLAVQAA
EGLLRQGNAYGEQAQEAVTRLLEKSQENQLRAHQWMQKLHDQLGLQHFLRDCHELDGWIH
EKMLMARDGTREDGHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAASVR
KKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKKLLHMESQLQDVDPGGDL
ATVNSQLKKLQSMESQVEEWYREVGELQAQTAALPLEPASKELVGERQNAVGERLVRLLE
PLQERRRLLLASKELHQVAHDLEDELAWVQERLPLAMQTERGSGLQAVQQYIKKNQGLRR
EIQAHGPRLEEVLERAGALASLRSPEAEAVRRGQEQLQGAWAGLREAAERRQQVLDAAFQ
VEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLSR
QCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVGLEQQYWLYQLSRQVDELEHW
IAEKEVVAGSPELGQDFEHVTVLQEKFSEFASETGTAGRERLAAVNQMVDELIECGHTAA
ATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRLTT
PPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEVLQ
GWKELLAACEDARLHVSSTADALRFHNQARDLLSWMDGIAGQIGAADKPRDVSSVEVLMN
YHQGLKTELEARMPELTACQELGRSLLLNKSAMADEIQAQLDKLGTRKEEVSDKWDRHWE
WLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEE
RFSSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGSERGLEPLAR
RASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEVPGRVEPTAQPAAPEDAAETPGAPA
VVAAEQVRPRPERQESADRAEELPRRRRPERQESADQSEEAARRRRPERQESTEHEVAHS
LTLGRYEQMERRRERRERRLERQESSEQEMPIRGDLAKGKATLADIVEQLQEKEAGPGLP
VGPSLPQPRELPPGRLPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRS
APAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDA
KGPASGGTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLE
AVAASVGEHAEIARWGQTQPTTSSTDEGNPKREAGERRASGRRK
Download sequence
Identical sequences E1BLT3
NP_001179839.1.59421 NP_001179839.1.76553 ENSBTAP00000007434 ENSBTAP00000007434 9913.ENSBTAP00000007434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]