SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007578 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007578
Domain Number 1 Region: 284-478
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.02e-49
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 
Domain Number 2 Region: 456-577
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007578   Gene: ENSBTAG00000047035   Transcript: ENSBTAT00000007578
Sequence length 652
Comment pep:known chromosome:UMD3.1:18:56681333:56691335:1 gene:ENSBTAG00000047035 transcript:ENSBTAT00000007578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAGYRVVFEKGGVYLHTSAKKHQDPDSLIAGVIRVVEKDNDVLLHWAPIEEAGDSSQI
FFSKKDTSGGDSCTSEEEPTFDPGYEPDWAVISTVRPRPRHSEPKRGAEPSSPRGSWAFS
VSLGELRSIRRSKPGLSWAYLVLVTQAGGSLPALHFHRGGTRALLRVLSRYLLLASSPQD
SRLYLVFPHDSSALSSSFHHLQLFDQDSSNVVSRFLQDPYSTTFSSFSRVTNFFRGALQP
HLEGTSPDLPPAPDDEPEPGFEVISCVELGPRPAVERAPPVTEEEWASHVGPEGRLQRVP
ELKARIFSGGLSPSLRREAWKFLLGYLSWEGSMEEHKAHVRKKTDEYFRMKLQWKSVSPE
QERRNSLLHGYRSLIERDVSRTDRTNKFYEGPENPGLGLLNDILLTYCMYHFDLGYVQGM
SDLLSPILYVTQNEVDAFWCFCGFMELVHGNFEESQETMKRQLGQLLLLLRVLDPPLCDF
LDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTGLPGPNLHLLVACAILDMERDT
LMLSGFGSNEILKHINELTMKLSVEDVLTRAEALYRQLTACGELPHNVQEVLGLASPAEP
QSPSPSASPLPLSPTRAPPAPLPPADTATATQPDSSLEILPEEEDDEEGVES
Download sequence
Identical sequences F1N196
ENSBTAP00000007578 ENSBTAP00000007578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]