SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007630 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007630
Domain Number 1 Region: 123-288
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-37
Family Dual specificity phosphatase-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007630   Gene: ENSBTAG00000005803   Transcript: ENSBTAT00000007630
Sequence length 796
Comment pep:known chromosome:UMD3.1:8:86801735:86817127:1 gene:ENSBTAG00000005803 transcript:ENSBTAT00000007630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDPPRRLSAVPFLSSFFEGRRHSASDPILRLQQGQRSSAAKVLSSSSLQVMVAMSSVSC
AERNPTCPERKRNSGRPTPKYTKVGERLRHVIPGHVACSMACGGKACKYENAARWSEQEQ
AVKGIYSSWVTDNILAMARPSTEVLEKFCIIEQFRSHGIKSIINLQRPGEHASCGNPLEQ
ESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGR
TGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLIPLRNIFSCCDP
KAHAVTLAQYLIRQRHLLHGYEARLLKHIPKIIHLVCKLLLDLAENRPVVTEVADIPGLS
AEIEKTVSEMITRQLDKELLRHDSDASDSFTPTAVVMDFENQDVVLSSEQELDPLWKRRN
VECLQPLAHLKRQLSYSDSDLKRAESLLEQGRTPWTVPAQALLCHNPRQQKHISRCYSPQ
SPQLDLNKETLVRNTFSFWNHTKFGVPEGLKDDGSSIFHRTSIPKEVQRSRTFSSGISDS
YNPGEPVTPNFANIPKGPNSSQQKVYHCECESHGGCGPSSVAEDGETCRRPVDCGSSPKA
QFLGNETQNSKYLSEVAAHMPLQSELSVEARRILAAKALANLNEIAEKEEVKKKVEMWQK
ELNSRDGAWERICGEKDPFILCSLMWSWVEQLKEPVITKEDMDMLVDRCADASEALFLLE
KGQQQTILCVLHCIVSLQTIPADVEEAVLARAIKAFTKVNFDSENGPIVYNTLKKIFKRT
LEEKRKMTKDNPEPGI
Download sequence
Identical sequences F1N3G1
ENSBTAP00000007630 ENSBTAP00000007630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]