SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007704 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007704
Domain Number 1 Region: 313-373
Classification Level Classification E-value
Superfamily Leucine zipper domain 1.84e-17
Family Leucine zipper domain 0.0000996
Further Details:      
 
Domain Number 2 Region: 3-31
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000671
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007704   Gene: ENSBTAG00000005863   Transcript: ENSBTAT00000007704
Sequence length 462
Comment pep:known chromosome:UMD3.1:5:26580498:26671702:1 gene:ENSBTAG00000005863 transcript:ENSBTAT00000007704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDDRPFVCNAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARTDSVIIADQTPTPTRFLKN
CEEVGLFNELANSFEHEFKKAADEDEKKAASGPLDMSLPSTPDIKIKEEEPVEDVAPKPV
VISTPTPTIVRPGSLPLHLGYDPLHPTLPSPTSVITQAPPSNRQLGSPTGSLPLVMHLAN
GQTMPVLPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPMPSEAKMRLK
ATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGG
RRRRTVDEDPDERRQRFLERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLL
RNEVAQLKQLLLAHKDCPVTALQKKTQGYLESPKESSEPTGSPAPVIQHSSATAPSNGLS
VRSAAEAVATSVLTQMASQRTELGMPIQSHVIMTPQSQSAGR
Download sequence
Identical sequences F1N1U0
ENSBTAP00000007704 NP_001179772.1.59421 NP_001179772.1.76553 XP_005902175.1.15283 ENSBTAP00000007704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]