SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007717 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007717
Domain Number 1 Region: 111-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 729-779
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 76-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000324
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 154-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000135
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 769-814
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000194
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007717   Gene: ENSBTAG00000005871   Transcript: ENSBTAT00000007717
Sequence length 1051
Comment pep:known chromosome:UMD3.1:1:99090972:99143289:1 gene:ENSBTAG00000005871 transcript:ENSBTAT00000007717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEDDFQQ
KLETENDLREIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKH
PPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESD
KEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASI
AEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPS
EVKKLQKGSSESPFDLTTKRKDEKPLTPVPAKPSATPAASQDQPLDLSMGSRSRASGTKL
TEPRKNHVFGEKKGGNIEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYL
RPSPGFLFHPQFQLPDQRTWMSAIENMAEKLENFSALKPEASELLQSVPSMFNFRAPPNA
LPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHV
RNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKE
DAYFTEIRNFIGNSNHGSQSPRNAEERMNGSHFKDEKALVTNQNSDLLDDEEVEDEVLLD
EEDEDNDITGKMGKEPGTSNLHEGNPEDDYEDTSTLEMSCKASPMRYKEEEYKTGLSALD
HIRHFTDSLKMRKMEDNQYTEAEVSSFSASHVPEELKQPLHRKSKSQAYAMMLSLSDKES
LHSSSHSSSNVWHSMARAAAESSAIQSISHV
Download sequence
Identical sequences E1BMZ2
ENSBTAP00000007717 ENSBTAP00000007717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]