SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007787 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007787
Domain Number 1 Region: 17-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-91
Family Calponin-homology domain, CH-domain 0.00000144
Further Details:      
 
Domain Number 2 Region: 2218-2339
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-34
Family Pleckstrin-homology domain (PH domain) 0.0000018
Further Details:      
 
Domain Number 3 Region: 297-419
Classification Level Classification E-value
Superfamily Spectrin repeat 9.81e-34
Family Spectrin repeat 0.0000609
Further Details:      
 
Domain Number 4 Region: 914-1069
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-30
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 1021-1175
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-27
Family Spectrin repeat 0.0000425
Further Details:      
 
Domain Number 6 Region: 1862-2017
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1233-1386
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-26
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 8 Region: 1651-1804
Classification Level Classification E-value
Superfamily Spectrin repeat 8.14e-26
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 9 Region: 1489-1601
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-20
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 10 Region: 1388-1500
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-20
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 11 Region: 429-527
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-19
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 12 Region: 822-955
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-18
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 13 Region: 532-600
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000012
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 14 Region: 2022-2083
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000302
Family Spectrin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007787   Gene: ENSBTAG00000005929   Transcript: ENSBTAT00000007787
Sequence length 2397
Comment pep:known chromosome:UMD3.1:29:45358814:45438945:-1 gene:ENSBTAG00000005929 transcript:ENSBTAT00000007787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVD
KALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKD
ALLLWCQMKTAGYPNVNVNNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNA
FNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHA
MEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFT
EKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQ
EKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGR
VQAVDAVAAELAAERYHDIKRIAARQHNVSRLWDFLRQMVAARRERLLLNLELQKVFQDL
LYLMDWMEEMKGRLQSQDLGKHLTGVEDLLQLHELVEADIAVQAERVRAVSASALRFCDP
GKVVLCCSPNLKTEIVGNLQEKPGKSCKAEAHKSEGLHTSRRLWEGFYIFKYKLMQLWAL
YDFVREYQCLFLCLNSYREQTEVSNGMNKYVLATSELSGGLNNTYARICTGHPFLLSSSG
GPKSNSGLSSSGSQRIQAVRIAYLYEKKWQQQRTSSLGQFSHKAQDNMAARIAALYFISS
NRKRSHEFSTRSFSLKTRSLSKRIPFLPLPTLKIPGSNLVVLPNFHKTDTKGLITEMEKN
YKEVVSRFWARALALEGSIKHYTLLMERGSCXLWVEEKEQWLNGLALPERLEDLEVVQQR
FETLEPEMNALAARITAVNDIAEQLLKANPPGKDSIVNTQKQLNHRWQQFRSLADGKKAA
LTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAA
RVGELTREANALAAGHPAQAPAINARLGEVQAGWEDLRATMRRREESLGEARRLQDFLRS
LDDFQAWLGRTQTSVASEEGPATLPEAEALLAQHAALRGEVERARSEYSQLRAVGEEVTR
DQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEY
VLSHTEMPGTLQAADATIKKLEDFMSTMEANGERIRGLLEAGRQLVSEGNVHAEKIQEKA
DSVERRHKKNQEAVQQLLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLH
TKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVWEKLEDLHRRWDELETTTQ
AKARSLFDANRAELFAQSCSALESWLESLQAQLHSDDYGKDLTSVNILLKKQQMLEREMA
VREKEVEAIQAQAKALAQEDQGAGEVERTSRAVEEKFRALCQPMEERCRRLQASREQHQF
HRDVEDEILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLTERQRT
LGVAAAGPELAELQEMWKRLGHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMG
QEKAKDELSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPENTRLSIRQAQVD
KLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLR
DKFREFSRDTSTIGQERVDGANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTR
GQVLAAAHELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAFEHDIQALS
AQVQQVQDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFF
KAVRELMLWMDGVNLQMDAQERPRDVSSADLVIKNHQGIKAEIEARADRFSSCVDMGQGL
LARSHYAAEEISEKLSQLQARRQETADKWQEKMDWLQLVLEVLVFGRDAGVAEAWLCSQE
PLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEEQEKERKRKREEEE
RRKLPPPPEPPASPPEGHLVDSHTAPATARDGPCRSRVHPRLPASVNGVCTDAEGPQPLM
EQQRLEQGGLPEGPGSGAGDEANGPRGEKQARTQGPTPPIMPQSRSSESARVATLPTRGP
ELSAQEQMEGLLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVPYHGE
VPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSA
SGEPEEPAVPSATRGMTRAMTMPPVSPAGAEGPVVLRSKDGREREREKRFSFFKKNK
Download sequence
Identical sequences E1BMN5
ENSBTAP00000007787 ENSBTAP00000007787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]