SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008112 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008112
Domain Number 1 Region: 206-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 266-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 310-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000951
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 166-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000589
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008112   Gene: ENSBTAG00000006170   Transcript: ENSBTAT00000008112
Sequence length 571
Comment pep:known chromosome:UMD3.1:23:9196406:9235677:1 gene:ENSBTAG00000006170 transcript:ENSBTAT00000008112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLGLQTVTLSDGTTAYVQQAVKGDKLLEGQVIQLEDGTTAYIHQVTVQKEPLSFEDGQ
PVQLLEDGSTAYIHQTPTQGYDPSALEAVQLEDGSTAYIHHPVAVPSDGAILAVQTEVGL
EGLAAEDDEGFSADTVVALEQYTSKVLHESQAPHNGKGQQVGDRAFRCGYKGCGRLYTTA
HHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHMRTHTGEKPYKCPEELCSKAFKTS
GDLQKHVRTHTGERPFRCPFEGCGRSFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSA
TNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVHTHCKPYTCSTCGKTYRQTST
LAMHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPHIAYVSEVKEEGDDLPT
QVAMVTEEDGAPQVALITQDGAQQVSLSPEDLQALGSAISMVTQHGSTTLAIPSHDDTLA
TSGAHTVAMVSADGTQTQPVTIITSGTVVAEDSSVASLHHQQVALLATANGTHIAVQLEA
QQTLEEAISVATAAMQRGAATLETAESESSC
Download sequence
Identical sequences E1BND9
ENSBTAP00000008112 ENSBTAP00000008112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]