SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008305 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008305
Domain Number 1 Region: 41-176
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.19e-20
Family Canonical RBD 0.004
Further Details:      
 
Domain Number 2 Region: 223-319
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000739
Family Canonical RBD 0.005
Further Details:      
 
Domain Number 3 Region: 176-211
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000628
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000008305
Domain Number - Region: 639-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00595
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008305   Gene: ENSBTAG00000006330   Transcript: ENSBTAT00000008305
Sequence length 815
Comment pep:known chromosome:UMD3.1:22:50789615:50813736:-1 gene:ENSBTAG00000006330 transcript:ENSBTAT00000008305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDDRRGDRYDDYRDYDSP
ERERERRNSDRSEDGYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMES
FEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRP
KFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYYCDTIILRNIAP
HTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP
LKIDGKTIGVDFAKSARKDLVLPDGNRVSAFSVASTAIAAAQWSSTQSQSGEGGSVDYSY
LQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTS
NPPSSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYY
DPNSQYYYNSLTQQYLYWDGEKETYMLAAESNSHQQTGLPPAKEGKEKKEKPKSKTAQQI
AKDMERWAKSLNKQKENFKNSFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLIP
ELVRNGDEDNPLKRGLVAAYSGDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNKD
ALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEP
KRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLK
GAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME
Download sequence
Identical sequences Q1RMU5
9913.ENSBTAP00000008305 NP_001039839.1.59421 NP_001039839.1.76553 XP_010850136.1.44457 XP_019840052.1.53367 ENSBTAP00000008305 ENSBTAP00000008305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]