SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008427 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008427
Domain Number 1 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 450-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 391-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 545-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-20
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 353-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 195-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000137
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 293-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000149
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008427   Gene: ENSBTAG00000006428   Transcript: ENSBTAT00000008427
Sequence length 606
Comment pep:known chromosome:UMD3.1:7:41154755:41179540:-1 gene:ENSBTAG00000006428 transcript:ENSBTAT00000008427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEQREARSQVSVTFEDVAVLFTRDEWRKLAPPQRNLYQDVMLENYNNLVSLGHLFPKP
KVISLLQQGEDPWKVEKESPGGSSLGWKNSYKTTKSTQTQDRSFQELIMKRSKRSGPWDF
KSEKPCRYEGRLEKKQEKKESVQIVSVTHRKILTIERKHKNTQFGQNLCPKSVFFRQQVI
PREKAPPKCEIQGNSFKQNFSLFNQQKTNTAGKRYKCSMCEKTFINTSSLRKHEKNHSGE
KLFKCKDCSKAFNQSSALIQHQITHTGEKPYICKECGKAFTLSTSLYKHLRTHTVEKSYR
CKECGKSFSRRSGLFIHQKIHAGENPYKYNPGRKASSCSTSLPGCQRIHSRKKSYLCNEC
GNTFKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCNECGKGF
TSISRLNRHRIIHTGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSS
ALIQHQRMHTGERPYKCNECGKTFRCNSSLSNHQRIHTGEKPYRCEDCGISFGQSSALIQ
HRRIHTGEKPFKCNTCGKTFRQSSSRIAHQRIHTGEKPYECNTCGKLFNHRSSLTNHYKI
HIEENP
Download sequence
Identical sequences E1BJG4
ENSBTAP00000008427 NP_001243494.1.59421 NP_001243494.1.76553 XP_010844794.1.44457 XP_010844795.1.44457 ENSBTAP00000008427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]