SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008495 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008495
Domain Number 1 Region: 203-550
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.14e-93
Family Calpain large subunit, catalytic domain (domain II) 0.00012
Further Details:      
 
Domain Number 2 Region: 691-812
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.07e-25
Family Calpain large subunit, middle domain (domain III) 0.0018
Further Details:      
 
Domain Number 3 Region: 546-682
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.27e-23
Family Calpain large subunit, middle domain (domain III) 0.0072
Further Details:      
 
Domain Number 4 Region: 79-164
Classification Level Classification E-value
Superfamily MIT domain 1.06e-18
Family MIT domain 0.0023
Further Details:      
 
Domain Number 5 Region: 2-81
Classification Level Classification E-value
Superfamily MIT domain 0.0000000000000405
Family MIT domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008495   Gene: ENSBTAG00000006479   Transcript: ENSBTAT00000008495
Sequence length 813
Comment pep:known chromosome:UMD3.1:1:153971502:154021605:1 gene:ENSBTAG00000006479 transcript:ENSBTAT00000008495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSAALERDAVQFARLAVQRDQEGRYAEAVFYYKEAAQALIYAEMAGSSLEHIQEKINEY
LERVQALHSAVQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKGNVEDAIELYTEAVDLC
LKTSYETADKTLQNKLKQLARQALDRAEALSEPLTKQSCKIKATNTKPKPPPTRTHFPLG
TNPFLERPQPFISPQSCDAQGQRYTAEEIEVLRTTSKINGIEYVPFMSIDLRERFAYPMP
FCDRCGKLPLSPKQKATFSKWVRPEDLTNNPTMIYTVSSFSIKQTIVSDCSFVASLAISA
AYERRFNKKLITSIIYPQNKDGEPEYNPCGKYMVKLHLNGVPRKVIIDDQLPVDHKGELL
CSYSNNKSELWVSLIEKAYMKVMGGYDFPGSNSNIDLHALTGWIPERIAMHSDSQAFSKD
NSFRMLYQRFHKGDVLITASTGVMTEAEGEKWGLVPTHAYAVLDIREFKGLRFIQLKNPW
SHLRWKGRYSENDVKNWTPELQKYLNFDPRTAQKIDNGIFWISWDDLCQYYDVIYLSWNP
GLFKESTCIHSTWDAKQGPVKDAYSLANNPQYKLEVQCPQGGAAVWVLLSRHITDKDDFA
NNREFITMVVYKTDGKKVYYPADPPPYIDGIRINSPHYLTKIKLTTPGTHTFTLVVSQYE
KQNTIHYTVRVYSACSFTFSKIPSPYTVSKQINGKWSGQSAGGCGNFQETHKNNPIYQFH
IEKTGPLLIELRGPRQYSVGFEVVTVSVVGDPGPHGFQRKSSGDYRCGFCYLELENIPAG
IYNIIPSTFLPKQEGPFFLDFNSIIPIKTTQLQ
Download sequence
Identical sequences E1BIX3
ENSBTAP00000008495 ENSBTAP00000008495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]