SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008544 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008544
Domain Number 1 Region: 64-299
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.54e-54
Family G proteins 0.001
Further Details:      
 
Domain Number 2 Region: 284-363
Classification Level Classification E-value
Superfamily TGS-like 3.6e-18
Family G domain-linked domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000008544
Domain Number - Region: 5-43
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0693
Family PspA lactotransferrin-binding region 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008544   Gene: ENSBTAG00000006517   Transcript: ENSBTAT00000008544
Sequence length 364
Comment pep:known chromosome:UMD3.1:19:35099135:35107937:-1 gene:ENSBTAG00000006517 transcript:ENSBTAT00000008544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSSSSKGEGFDVMKS
GDARVALIGFPSVGKSTFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGII
EGAAQGKGRGRQVIAVARTADVVIMMLDATKGEVQRSLLEKELESVGIRLNKHKPNIYFK
PKKGGGISFNSTVTLTQCSEKLVQLILHEYKIFNAEVLFREDCSPDEFIDVIVGNRVYMP
CLYVYNKIDQISMEEVDRLARKPDSVVISCGMKLNLDYLLEMLWEYLALTCIYTKKRGQR
PDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLTHTMEHEDVIQ
IVKK
Download sequence
Identical sequences Q58D56
ENSBTAP00000008544 NP_001014865.1.59421 NP_001014865.1.76553 XP_006048924.1.26621 XP_011982818.1.54773 XP_017920271.1.57651 XP_019837503.1.53367 XP_020769869.1.74333 9913.ENSBTAP00000008544 ENSBTAP00000008544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]