SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008649 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008649
Domain Number 1 Region: 175-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.54e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000008649
Domain Number - Region: 153-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0457
Family Classic zinc finger, C2H2 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008649   Gene: ENSBTAG00000006587   Transcript: ENSBTAT00000008649
Sequence length 349
Comment pep:known chromosome:UMD3.1:8:84514066:84537863:-1 gene:ENSBTAG00000006587 transcript:ENSBTAT00000008649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRGVEAQMADNAPQPPPVIFCQDSPKRVLVSVIRTTPIKPTCGGGGEPEPPPPLIPTSP
GFSDFMVYPWRWGENAHNVTLSPGASGGAASAALPAAAATAEHLGLRGRGAPPPTVSAAA
ASGGEDEEEASSPDSGHLKDGIRRGRPRADTVRDLINEGEHSSSRIRCNICNRVFPREKS
LQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPFVCSENGCLSRFTHANR
HCPKHPYARLKREEPTDALSKPQAVDNQAAAEWLAKYWETREQRTPTLKGKLVQKADQEQ
QDPLEYLQSDEEDDEKSGAQRRLQEQRERLHGALALIELANLTGAPLRQ
Download sequence
Identical sequences E1BFV5
9913.ENSBTAP00000008649 NP_001192962.1.59421 NP_001192962.1.76553 XP_006063142.1.26621 XP_010834315.1.44457 XP_011988845.1.54773 XP_017907970.1.57651 ENSBTAP00000008649 ENSBTAP00000008649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]