SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008658 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008658
Domain Number 1 Region: 583-646,913-1032
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.54e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0062
Further Details:      
 
Domain Number 2 Region: 11-189
Classification Level Classification E-value
Superfamily RUN domain-like 4.05e-32
Family RUN domain 0.00073
Further Details:      
 
Domain Number 3 Region: 1009-1131
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008658   Gene: ENSBTAG00000006592   Transcript: ENSBTAT00000008658
Sequence length 1139
Comment pep:known chromosome:UMD3.1:17:67284515:67335715:1 gene:ENSBTAG00000006592 transcript:ENSBTAT00000008658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKERNHWREVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFLRSNKI
AALFMKVGKSFPPAEELSRKVQDLEQLIESARNQIQGLQENVRKLPKLPSLSPLAIKHLW
IRTALFEKVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTSDH
FWTDPSADELVQRHRIHSSHLRQDSPTKRPALCIQKRHSSGSMDDRPSLSARDYVESLHQ
NSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKSV
YWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQLLSCLENGL
LPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSSESTSSDKEDDEATDYVFRIIYPGMQSEL
VASSPLGGTPPISAGPAWMVVPAGRSALVVARGSRWAQARWDTTLPTSRLKPQSLIPQDL
MDVSVSNLPSLWQPSPRQSSCSSCSQSGSADGGSTNGCNHERAPLKLLCDNMKYQILSRA
FYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAGHGLTAGIWEQYLQDSTSYEEQELL
RLIYYGGIQPEIRKAVWPFLLGHYQFGMTETERKEVDEQIHACYTQTMSEWLGCEAIVRQ
RERESHAAALAKCSSGASLDSHLHQMMHRDSTISNESSQSCSSGRQNIRLQSDSSSSTQV
FESVDEAEQVEAEGRLEEKPTKIPNGNLVNGTCSPDSGHPSSHNFSSGLSEHSEPSLSTE
DSVMDAQRTAPLVLRPRDSSMDDGQSSEATTSRDEATREELAVQDSLESDLLANESMDEF
MSITSSLDVALPEKEGPAMEGWRGSEAEKQSQVDSEDNLSEEPEMESLFPALASLAVTTS
ANSEASPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRNYWYFTPANLEKLRNIMCSYI
WQHIEIGYVQGMCDLLAPLLVILDDEALAFSCFTELMKRMNQNFPHGGAMDTHFANMRSL
IQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELIYDDVFSVWETIWAAKHVSSAHYV
LFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNTKQVLKLARDLVYKVQTLIENK
Download sequence
Identical sequences F1MEY0
ENSBTAP00000008658 ENSBTAP00000008658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]