SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008678 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008678
Domain Number 1 Region: 3-294
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008678   Gene: ENSBTAG00000006616   Transcript: ENSBTAT00000008678
Sequence length 425
Comment pep:known chromosome:UMD3.1:13:79263518:79324185:1 gene:ENSBTAG00000006616 transcript:ENSBTAT00000008678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMEKEFEQIDRAGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEREMVFEDTNLKLTLISEDIKSYYTVRQLELENLMSRETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSREHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQEQWKELSHEDLE
PPPEHVPPPPRPPKRVLEPHNGKCKEFFPNHQWVKDDTEEEDKEDGPVQEATRAPLNAPC
SLESASQDTEVRRRVVGADPAQGEPSLPAEERDQPLSHWKPFLVNVCVATVLTAGAYLCY
RVCFH
Download sequence
Identical sequences A6QQN2
NP_001093796.1.59421 NP_001093796.1.76553 XP_019828134.1.53367 9913.ENSBTAP00000008678 ENSBTAP00000008678 ENSBTAP00000008678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]