SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008704 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008704
Domain Number 1 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-17
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 
Domain Number 2 Region: 327-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000213
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 3 Region: 235-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000506
Family Classic zinc finger, C2H2 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008704   Gene: ENSBTAG00000006631   Transcript: ENSBTAT00000008704
Sequence length 1105
Comment pep:known chromosome:UMD3.1:5:56321395:56331773:-1 gene:ENSBTAG00000006631 transcript:ENSBTAT00000008704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNSMTPPPVSSYGEPCCLRPLPSQGAPGMGTEGLPGLPFCHQATLMPGPHSYGPAREAN
SCTEVPLFPPPRSAVKLTKKRALSISPLSDTSLDLQTVIRTSPSSLVAFINSRCASPGGS
YGHLSIGTMSPSLGFSPQMNHQKGTSPSFGVQPCGPHDPTQSGMMPHPQSRGPLPTCQLK
SELGVLVNKCPEEPLEGDMSSPNSSSTQDPLLGMLDGREDLEREEKPEPDSVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPALSSVEPKRERDG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCLAGTGLSTLRRLENLRLDQLHQFRPMGPRGLKLPSLTHTGTPGSRRLGAPVSLD
RRSSSSSSVSSAYTVSRRSSLASPFPPGSPPENGASSLPGLTPAQHYLLRARYASARGGG
TPPTAAPSLDRTGALPAPPWRSRAEYPGYNPNVGVTRRASDPARSVDRPAPARVQRFKSL
GCVHNTPTVVGGGQNFDPQLPTSVYSPQPPSITENVSMDTRGLREEPEVGTSMMGSGLNP
YMDFPPADTLGYGGPEAAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQVPYSEPTPETW
SEFPSHSGLYSGPKAPAGAYSQCPRLEHYGQVQVKPEQGCPVGSDATGLAPCLNAHPNEG
PPRSQPLFSHYPQPPPPQYPQSGSYTQPPPDYLPSEARPSLDFESPTHSTGHLKAQLVCN
YVQSQQELLWDSGGRGDPPVQEPLYQSPKFLGGSQVSPSPAKAPVATYGPGFAPNMPNHK
PGSYPTPSCHENFAVGANKASHRAAAPPRLLPPLPACYGPLKAGGTNPSCGHPEVGRLGG
GPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHNQRDSSEHTPPPSGTP
NMAVGNMSVLLGSLPGETQFLNSSA
Download sequence
Identical sequences A6H727
9913.ENSBTAP00000008704 ENSBTAP00000008704 ENSBTAP00000008704 NP_001092470.1.59421 NP_001092470.1.76553 XP_005206643.1.76553 XP_010803470.1.76553 XP_010803471.1.76553 XP_015326575.1.76553 XP_019816513.1.53367 XP_019816514.1.53367 XP_019816515.1.53367 XP_019816516.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]