SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008736 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008736
Domain Number 1 Region: 205-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-20
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 2 Region: 261-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-19
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 317-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.59e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 362-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 93-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 542-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.61e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 515-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000008736
Domain Number - Region: 19-44,79-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00368
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008736   Gene: ENSBTAG00000006650   Transcript: ENSBTAT00000008736
Sequence length 619
Comment pep:known chromosome:UMD3.1:25:27431639:27440674:-1 gene:ENSBTAG00000006650 transcript:ENSBTAT00000008736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVESPEERSPAPGYKRSGRRYKCLSCTKTFPNAPRAARHAATHGLADCTEEMAEAKLKP
ETDPKAEDASGDKVSGAAAKPRPYACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRR
FMQPVCLRVHLASHAGELPFRCAHCPKAYGALSKLKIHQRGHTGERPYTCADCGKSFADP
SVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNHERSHTGERPFLCSECGKSFSRSSSLT
CHQRIHAAQKPYRCPACGKGFTQLSSYQSHERTHSGEKPFLCPRCGRMFSDPSSFRRHQR
AHEGVKPYRCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRHALVHSG
QRPFRCEECGRAFAERASLTKHSRVHSGERPFHCNACGKSFVVSSSLRKHERTHRSSEAT
GAPPQQELVVGLALPVSMAGEGPAAPASGAALGDPPAGLLGLPSESGGVMATQWQVVGMT
VEHVECQDAGVGEAPGPLGAAGEVGGEEVDEKPPQFVCRECKETFSTLTLLRRHERSHPE
LRPFHCTQCGKSFSDRAGLRKHSRTHSSVRPYTCPHCPKAFLSASDLRKHERTHPVPIGT
PTPLEPLVALLGMPEEGPA
Download sequence
Identical sequences Q2TA17
ENSBTAP00000008736 ENSBTAP00000008736 9913.ENSBTAP00000008736 XP_005225022.1.76553 XP_015315872.1.76553 XP_019843570.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]