SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008799 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008799
Domain Number 1 Region: 270-510
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 8.76e-38
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0092
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily SNARE-like 1.37e-31
Family Clathrin coat assembly domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008799   Gene: ENSBTAG00000006690   Transcript: ENSBTAT00000008799
Sequence length 511
Comment pep:known chromosome:UMD3.1:15:29754474:29783172:1 gene:ENSBTAG00000006690 transcript:ENSBTAT00000008799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLAAAVCTKAGKAIVSRQFVEMTRTRIEGLLAAFPKLMNTGKQHTFVETESVRYVYQP
MEKLYMVLITTKNSNILEDLETLRLFSRVIPEYCRALEENEISEHCFDLIFAFDEIVALG
YRENVNLAQIRTFTEMDSHEEKVFRAVRETQEREAKAEMRRKAKELQQARRDAERQGKKA
PGFGGFGSSTVSGGSTTSMITETIIETDKPKVAPAPARPSGPSKALKLGAKGKEVDNFVD
KLKSEGENIISSNMGKRTSEATKVHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGM
IMLRISDDKFGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVG
VLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAP
VIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFISKKNYCN
IQVTKVTQVDGNSPVRFSTETTFLVDKYEIL
Download sequence
Identical sequences P53619
ENSBTAP00000008799 NP_001181942.1.59421 NP_001181942.1.76553 XP_005897203.1.15283 XP_006044750.1.26621 XP_010828731.1.44457 XP_019830733.1.53367 9913.ENSBTAP00000008799 ENSBTAP00000008799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]