SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008854 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008854
Domain Number 1 Region: 284-345
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-21
Family SH3-domain 0.00059
Further Details:      
 
Domain Number 2 Region: 107-161
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000179
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000008854
Domain Number - Region: 347-401
Classification Level Classification E-value
Superfamily SH3-domain 0.00113
Family SH3-domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008854   Gene: ENSBTAG00000006735   Transcript: ENSBTAT00000008854
Sequence length 403
Comment pep:known chromosome:UMD3.1:22:10160885:10273691:1 gene:ENSBTAG00000006735 transcript:ENSBTAT00000008854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPPSGAREDGVDGLPKETASAEQPPSPASTGSQESKLQKLKRSLSFKTKSLRSKSADNF
FQRTNSDVKLQADVLAGVSPGSSPLPAPGSLTSTPTRAGLYPGGGGKAHAFQEHIFKKPT
FCDVCNHMIVGTNAKHGLRCKACKMSIHHKCMDGLAPQRCMGKLPKGFRRYYSSPLLIHE
QFGCIKEVMPIACGNKVDPVYETLRFGTSLAQRTKKSSSGSGSDSPHRTSTSDLVEVPEE
ADGPGDGYDLRKRSNSVFTYPENGTDDFRDQAKNINHQGPLSKDPLQMNTYVALYKFVPQ
ENEDLEMRPGDMITLLEDSNEDWWKGKIQDRIGFFPANFVQRVHQNEKIFRCVRTFSGCK
EQGQITLKENQICVASEEEQDGFIRVLSGKKRGLVPLDVLENI
Download sequence
Identical sequences F1MH98
9913.ENSBTAP00000008854 XP_019840496.1.53367 ENSBTAP00000008854 ENSBTAP00000008854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]