SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009064 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009064
Domain Number 1 Region: 197-509
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.24e-86
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000663
Further Details:      
 
Domain Number 2 Region: 1021-1288
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.63e-72
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000079
Further Details:      
 
Domain Number 3 Region: 504-707
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 1.31e-52
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00043
Further Details:      
 
Domain Number 4 Region: 1291-1420
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.94e-30
Family Anticodon-binding domain of Class II aaRS 0.00014
Further Details:      
 
Domain Number 5 Region: 1424-1511
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 8.44e-17
Family C-terminal domain of ProRS 0.008
Further Details:      
 
Domain Number 6 Region: 751-804
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 9.42e-17
Family a tRNA synthase domain 0.0000671
Further Details:      
 
Domain Number 7 Region: 825-878
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 3.65e-16
Family a tRNA synthase domain 0.0001
Further Details:      
 
Domain Number 8 Region: 50-162
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.25e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.019
Further Details:      
 
Domain Number 9 Region: 903-954
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000589
Family a tRNA synthase domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009064   Gene: ENSBTAG00000006898   Transcript: ENSBTAT00000009064
Sequence length 1511
Comment pep:known chromosome:UMD3.1:16:24171351:24236353:-1 gene:ENSBTAG00000006898 transcript:ENSBTAT00000009064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLCLTVNSGDPPLGALLAVEHVKDNVSISVEEGKENILHVSENVVFTDINSILRYLAR
IATAAGLYGSNLLEHTEIDHWLEFSATKLSSCDLFTSAVNELNHCLSLRTYLVGNSLSLA
DLCVWATLKGNAAWQEQLGQNKAPVHVKRWFGFLEAQQAFQSVGTKWNVSATKAKVVPEK
KQDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMK
AEREQRIESKHRENSVEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNKGCMRDPTLYRCK
IKAHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPFI
WEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGS
SRSVVNMEWDKIWAFNKKVIDPVAPRYVALLKKEVVPVNIPEAQEEMKEVAKHPKNPDVG
LKPVWYSSKVFIEGADAETLSEGEMVTFINWGNINITKIHKSAEGKIVSLDAKLNLENKD
YKKTTKITWLAETEHALPVPAICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELMLGDPC
LKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCIEAPCILIYIPDGHTKEMPTSGSKEKTK
VETTKNEASTPLKTRSAPSLSTCATSEDSLVLYNRVAAQGDVVRELKAKKATKEDIDAAV
KQLLALKAEYKEKTGQEYKPGNPPAAVGQNISSKSSSNIVESKSLYDEVAAQGEVVRKLK
AEKAPKAKVNEAVECLLSLKAQYKEKTGKEYVPGQPPSSQSSDSSPPRSSEPSGPETPEA
KLLFDKVASQGEVVRKLKAEKASKDQVDTAVQELLQLKAQYKSLAGVDYKPVSATGAEEK
DKKKKEKENKSEKQNKPQKQNDSQKKDSFKTQGSGLSPNGAGEGQGPKKQTRLGLEARKE
DSLADWYSQVITKSEMIEYYDVSGCYILRPWAYSIWESIKDFFDAEIKKLGVENCYFPMF
VSQGALEKEKTHIADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLP
VKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAAEEVLQILDLYARVYEELL
AIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIVFEDPKT
AGEKQFAYQNSWGLTTRTIGVMTMVHGDNVGLVLPPRVACVQVVVIPCGITNALSEEDRD
ALLAKCSDYQRRLLSVNIRVRVDLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKNCQFVA
VRRDTGEKLTIAENEAETKLHAILEDIHINLFTRASEDLKTHMVVANTMEDFQKELDSGK
IAQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELPPGAKCVCGKNP
AKYYTLFGRSY
Download sequence
Identical sequences G3X6L9
ENSBTAP00000009064 ENSBTAP00000009064 NP_001230249.1.59421 NP_001230249.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]