SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009160 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009160
Domain Number 1 Region: 23-327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.41e-80
Family G proteins 0.000000204
Further Details:      
 
Domain Number 2 Region: 305-386
Classification Level Classification E-value
Superfamily TGS-like 6.32e-36
Family G domain-linked domain 0.0000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009160   Gene: ENSBTAG00000006970   Transcript: ENSBTAT00000009160
Sequence length 396
Comment pep:known chromosome:UMD3.1:2:22564518:22728762:1 gene:ENSBTAG00000006970 transcript:ENSBTAT00000009160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPN
ESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGI
FHLTRAFEDDDITHVEGSVDPVRDIEIIHEELQLKDEEMVGPIIDKLEKVAVRGGDKKLK
PEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKK
NKWLIKIKEWVDKYDPGALVIPFSGALELRLQELSAEERQKYLEANMTQSALPKIIKAGF
AALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSEN
AVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK
Download sequence
Identical sequences Q2HJ33
ENSBTAP00000009160 NP_001039510.1.59421 NP_001039510.1.76553 XP_010858115.1.44457 ENSBTAP00000009160 9913.ENSBTAP00000009160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]