SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009208 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009208
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2190-2309
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-38
Family Pleckstrin-homology domain (PH domain) 0.00000198
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 603-742
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-32
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 5 Region: 1011-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-28
Family Spectrin repeat 0.0000223
Further Details:      
 
Domain Number 6 Region: 1539-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 1.82e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 7 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 6.27e-28
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 8 Region: 1858-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 1.64e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 908-1059
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-27
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 10 Region: 811-951
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 11 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 1698-1803
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 13 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 14 Region: 1384-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-18
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 15 Region: 2017-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000317
Family Spectrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000009208
Domain Number - Region: 1171-1242
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0216
Family Spectrin repeat 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009208   Gene: ENSBTAG00000006995   Transcript: ENSBTAT00000009208
Sequence length 2363
Comment pep:known chromosome:UMD3.1:11:37030009:37241384:1 gene:ENSBTAG00000006995 transcript:ENSBTAT00000009208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIGIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKI
LSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIA
YIREQWAHLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ
SLVKKHKDVAEEIANYRPTIDSLHEQASALPQEHAESPDVQGRLAGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQSLLSQSHAHQQFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN
REAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDAN
KAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQ
SQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKQNLLASKEIHQFNRDVEDEILW
VGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSLNAE
AIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKA
KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYA
GLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR
EFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQIL
AASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVR
QLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSMVR
DLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARK
HYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLS
SREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPP
SPEPSTKVSEETESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGAAEQRTSS
KESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRS
WHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLND
GNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSESS
PGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences F1MYC9
NP_001179205.1.59421 NP_001179205.1.76553 XP_005212688.1.76553 XP_005212689.1.76553 XP_005907368.1.15283 XP_015328925.1.76553 ENSBTAP00000009208 ENSBTAP00000009208 9913.ENSBTAP00000009208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]