SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009210 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009210
Domain Number 1 Region: 539-566,609-692
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000141
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009210   Gene: ENSBTAG00000007001   Transcript: ENSBTAT00000009210
Sequence length 706
Comment pep:known chromosome:UMD3.1:6:109090378:109092922:-1 gene:ENSBTAG00000007001 transcript:ENSBTAT00000009210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASPEYTEWGGQLVLVRRRPPPPPGLGEVLKAGLRRSCACSLQGTWAQLQALFPAVHWL
RQYRPREALVGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELLLAGFDPAQDGLGPGANRSSLNGSAAALVLGLQDCARDC
YAIRVATALTLVAGLYQVLMGILGLGFVSAYLSQPLLDGFAMGASVTILTSQLRHLLGVR
VPRHQGPGLVVSTWLSLLRSAGQANLCDVLTSAVCLAVLLAAKELSDRFRHRLRVPLPAE
LLVIVVATIVSHLGQFHERFGSSVAGDIPTGFMAPRVPDAGLMWRVALDAASLALVGSAF
SISLAEMFARSHGYAVRANQELLAVGCCNVLPAFFHCFATSAALAKSLVKTATGCHTQLS
SVVSAAVVLMVLLVLAPLFRDLQRSVLACVILVSLRGALRKVRDVPRLWRLSPADALVWV
ATAATCVLVSTEAGLLAGVLFSLLSLAGRTRHPRTALLARAGGSSFYGDPAEFEGLAPEP
GVQVFRFTGPLYYANKDFFLQSLYSLTGLDVGYAIARRKERGPGEGAGEGDPVGGRDPGS
GSGGASLVPAVTRFHAVVIDCAPLLFLDVAGLATLQELHRDYGALGISLLLACCNPSVTD
TLRRGGFLGEDQGDVAEDGQLFPSVHCAVQAARARHQELAASNSIL
Download sequence
Identical sequences E1BDR3
9913.ENSBTAP00000009210 ENSBTAP00000009210 XP_002688491.1.76553 XP_005198764.1.59421 XP_015319361.1.59421 XP_015327238.1.76553 ENSBTAP00000009210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]