SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009267 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009267
Domain Number 1 Region: 32-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.1e-45
Family Frizzled cysteine-rich domain 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009267   Gene: ENSBTAG00000007047   Transcript: ENSBTAT00000009267
Sequence length 581
Comment pep:known chromosome:UMD3.1:17:47935477:47937432:-1 gene:ENSBTAG00000007047 transcript:ENSBTAT00000009267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPARGSGMFPPLLRPQRPHSAQEH
QLKDGGPGRAGCDNPGKFHHVEKSASCAPLCTPGVDVYWSRDDKRFAVVWLAVWSVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGNMDINALTGFVLIPLACYLIIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNVEYWKVLATQHK
CKMNNQTKNLDCLMTTSIPAVEIFMVKIFMLLVVGITSGMWVWTSKTLQSWQNVCSRRFK
KKSRRKPASVITSSGIYKKAQHPPKTHLGKYEIPAQPPTCV
Download sequence
Identical sequences A3KMX5
9913.ENSBTAP00000009267 ENSBTAP00000009267 NP_001091502.1.59421 NP_001091502.1.76553 ENSBTAP00000009267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]