SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009273 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009273
Domain Number 1 Region: 2051-2121
Classification Level Classification E-value
Superfamily Homeodomain-like 8.98e-18
Family Homeodomain 0.0041
Further Details:      
 
Domain Number 2 Region: 1845-1913
Classification Level Classification E-value
Superfamily Homeodomain-like 8.13e-17
Family Homeodomain 0.0053
Further Details:      
 
Domain Number 3 Region: 1585-1654
Classification Level Classification E-value
Superfamily Homeodomain-like 1.92e-16
Family Homeodomain 0.0051
Further Details:      
 
Domain Number 4 Region: 2142-2185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000271
Family HkH motif-containing C2H2 finger 0.0072
Further Details:      
 
Domain Number 5 Region: 1192-1216,1245-1270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000605
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 6 Region: 498-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000398
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000009273
Domain Number - Region: 2475-2523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000139
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number - Region: 560-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000246
Family Classic zinc finger, C2H2 0.06
Further Details:      
 
Domain Number - Region: 1674-1694,1765-1792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000351
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 814-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00116
Family Classic zinc finger, C2H2 0.065
Further Details:      
 
Domain Number - Region: 1471-1502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00608
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 453-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0427
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 867-907
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0615
Family HkH motif-containing C2H2 finger 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009273   Gene: ENSBTAG00000007053   Transcript: ENSBTAT00000009273
Sequence length 2571
Comment pep:known chromosome:UMD3.1:10:21245092:21257926:1 gene:ENSBTAG00000007053 transcript:ENSBTAT00000009273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLNLSSDTGTTPSPGHDAPSLPLDTSSPSTPSDPVTKDPPDAPSPSESMRSLEAGGQP
LESGCGLVPPKEIGEPQEEPGCGGFPPKDLGVDEDKEQEEEEEGELPPVDLSDHLFFTTG
GEACLVAKLFPAGDSELPLPKGFPRGEAGVKQESSLPLLAHLPPVHLTALHVQHGFDPIQ
GFSSSDQILSHDTSAPSPATCEGRDGAFWSYQLAPNPPGDPKDGPTGSRGGDPRALFWLC
LLCRLGFSRHQAFVGHTRSHGVKLTAAQHQGLLGNPAVLQEGDEACMALLSFLEPNLPAR
PLERPLDNSSTVNAEANAAQTKNGPPMAEAQAPVPPMDEVMALSPPSPETTPATWDPSPT
QAKESPTLAGEAGPDWFPEGHEEDGGLCPPLNQSSPASKEGGTLPALGGSPEDPGDPAQP
YRLADDYSLAPSAFQGLSLSSHMSLLHSRNSCKTLKCPKCNWHYKYQQTLDVHMREKHPE
SNSHCSYCTAGGAHPRLARGESYNCGYKPYRCEVCNYSTTTKGNLSIHMQSDKHLANLQG
FQAGPGGQGSPQEAVVPPPAGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEKHLQNVL
MLHQGLPLGLPPGLVGPSPPPQAGAAPATPPDLFQYFGPQALGQPQAPLPGPGLRPDKPL
EAQLLLNGFHHLGAPARKFPAPAPGSPSPDTHLPQSQLLGALSDGLPTSPPPDDSPSLKV
FRCLVCQAFSTDSLELLLYHCSMGRSLPEAEWKEVAGDTHRCKLCCYGTQLKANFQLHLK
TDKHAQKYQLAAHLREGGGAMGTPSPVPLGDGAPYGSVPTLHLRCNICDFESNSKEKMQL
HARGAAHEENSQIYKFLLEMEGTATAGPELGLFRCLLCAWETPSRLAVLQHLRAPAHRDA
QAQRRLQLLQRGPATDEGLPALQSILSFSHGQLRPRGKTPVTLLAGPPTPEKDAQSKTEQ
LVSEEAENKTGPLGDSANQTTAFCCPFCSFLSPESEQVRAHALSQHAVQPTFRCPLCQEQ
LVGRPALHFHLSHLHNVVPECVERLLLVATTVEMTLTTKVLPGPALSPLGDGPEPPSPAP
EPVPSRAQAAEGPHLTPEASPDPLPEPPPPSVEAPDKPTGSPDQPPSPAQSPAPRPDAQA
EEVAPPPAMAEEEEGAGGEPRPAEPAPADSRHPLTYRKTTNFALDKFLDPARPYKCTVCK
ESFTQKNILLVHYNSVSHLHKMKKAAIDPSGPAREAGTTPATAAATDKPFKCTVCRVSYN
QSSTLEIHMRSVLHQTRSRGAKTDAKAEGPERGPEEPKEGETEGEAGPEKKGPEPGGFLS
GLPFLSPPPPPLDLHRFPAPLFTPPVLPPFPLMPESLLKLQQQQLLLPFYLHDLKVGPKL
ALAGPAPLLSLPAAAPPPPPPPPKAELAEQEWERPPTTEEGAEAGPPSPLHPTPNEAART
AAKALLENFGFELVIQYNEGKQTVPPPPTPPPPEALGGGDKLACRACGKLFSNMLILKTH
EEHVHRRFLPFEALSRYAAQFRKSYDSLYPPPAESPKPPDGPLDSPAPQLGPPFLVPEPE
VGGARPPEERGRAGGRWPPEEDESARGNLPPLVPAGRRFSRTKFTEFQTQALQSFFETSA
YPKDGEVERLASLLGLASRVVVVWFQNARQKARKNASDGGPAPSGGGTGGASGCRRCHAT
FSCVFDLVRHLKKCYDDQPADDEEEEAERGEEEEEAEDDAEEEQGPEPPAGPEGPPPEPP
DREDLGQAEATKPEGKEPEGRAPPSPSPVHTCDQCALSFPNQDLLANHRRLHFLPPVQPS
AAPHLLDLPMLVFGERNPLVAGTPPVPPLKRKHEDGSLSPTGSEVGVGGEGEPPRDKRLR
TTILPEQLEILYRWYMQDSNPTRKMLDCISEEVGLKKRVVQVWFQNTRARERKGQFRSTP
GGVPNPAVKPPITPSPAPFPKFNLLLGKADDGAGREAPKRDAPALPYPTVTPAAGPLPFL
PPGKEPPTLTPEPLLPLPAPPPPCEDEGPEEPSKASPESEACSPSAGDLSDSSASSLAEP
ESPGAGGASGGPGGGGGVPDGMGQRRYRTQMSSLQLKIMKACYEAYRTPTMQECEVLGEE
IGLPKRVIQVWFQNARAKEKKAKLQGAAVGGAGGSSESPLAAQRTDCPYCDVKYDFYVSC
RGHLFSRQHLAKLKEAVRAQLKSESKCYDLAPAPEAAPAPKAPPATAPASVPLGAAPALP
RLAPVLLSGPALAQPPLGSLAPFSSGPAASSGLLGLATSVLPATTVVQTAGPGCPLPQRP
VPDQTKPSPAGTTDSAPGPPPEPSGDKVSGERKPVAAPTNSSADALKNLKALKATVPALL
GGQFLPFPLPPAGGATPPAVFGPQLPGAYFQQLYGMKKGLFPMNPVIPQTLIGLLPNALL
PPPPQAPEPTATAPPKPPELPAPREGEAGEADELLTGSPGISTVDVTHRYLCRQCKMAFD
GEAPATAHQRSFCFFGRGSGGSVPAPLRVPVCTYHCLACEVLLSGREALASHLRSSAHRR
KAAPPPGGPPGTATNAATAATAAVAFAKEEARLPHTDSNPKTTTTSTLLAL
Download sequence
Identical sequences E1BD77
ENSBTAP00000009273 9913.ENSBTAP00000009273 XP_002690489.2.76553 XP_015320467.1.59421 XP_015320468.1.59421 XP_015328549.1.76553 ENSBTAP00000009273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]