SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009301 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009301
Domain Number 1 Region: 35-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.52e-37
Family SCAN domain 0.0000795
Further Details:      
 
Domain Number 2 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-24
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 3 Region: 290-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009301   Gene: ENSBTAG00000031873   Transcript: ENSBTAT00000009301
Sequence length 348
Comment pep:known chromosome:UMD3.1:23:30305069:30312399:-1 gene:ENSBTAG00000031873 transcript:ENSBTAT00000009301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFLELEEQKRLLIVKAEDHYRGQDSISQKSSPHRRELFRQHFRKLCYRDAPGPREALI
QLWDLCRQWLRPECHTKEQILDLLVLEQFLSILPRDLQAWVQAHHPETGEEAVIVLEDLE
RELDEPRKQVPGNSERQDTLLDKLAPLRRPHESLTIQLHPKKTCQEQKSGEAQRNGDETK
TNTEELSQKEDKSKDMEFFGKINDRLNKDILQYPESKDAFESEGIFKWQQRKRRCYKCDD
CGKSFSHSSDLSKHRRTHTGEKPYKCDECGKSFIQRSHLIGHHRVHTGVKPYKCKECGKD
FSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY
Download sequence
Identical sequences Q3ZBI4
ENSBTAP00000009301 NP_001029583.1.59421 NP_001029583.1.76553 XP_015315420.1.76553 XP_015315421.1.76553 9913.ENSBTAP00000009301 ENSBTAP00000009301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]