SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009371 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009371
Domain Number 1 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-27
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 142-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 366-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-26
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 411-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 89-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009371   Gene: ENSBTAG00000007122   Transcript: ENSBTAT00000009371
Sequence length 464
Comment pep:known chromosome:UMD3.1:7:2371313:2394402:-1 gene:ENSBTAG00000007122 transcript:ENSBTAT00000009371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREGLWHSSLGETWEPDNWLEGQQENQDRHLGQVHITHKETLTERRTCGGNELERCSSQ
GSIIDIQQTIPVGKSPHNWNSHGKDTKQNAELIKTQRIFAGEKVYECNECGKTFSQSSSL
LKHQRIHTGEKPYKCNVCEKHFIERSSLTVHQRIHTGEKPYKCNECGKTFSQSMNLTVHQ
RTHTGEKPYQCKECGKAFRKNSSLIQHERIHTGEKPYKCNECGKAFTQSMNLTVHQRTHT
GEKPYECNECGKAFSQSMHLTVHQRSHTGEKPYECSECGKAFSKSSALTLHQRNHTGEKP
YKCNKCGKSFSQSTYLIEHQRLHSGVKPFECNQCGKAFSKNSSLTQHRRIHTGEKPYECM
VCGKHFTGRSSLTVHQVIHTGEKPYECSECGKAFSQSAYLIEHQRIHTGEKPYECDQCGK
AFIKNSSLIVHQRTHTGEKPYQCNECGKAFSRSTNLTRHQRTHT
Download sequence
Identical sequences A5D7K3 L8HW64
ENSBTAP00000009371 9913.ENSBTAP00000009371 NP_001091615.1.59421 NP_001091615.1.76553 XP_005907849.1.15283 XP_010829003.1.44457 XP_015327296.1.76553 XP_019819288.1.53367 XP_019819289.1.53367 XP_019819290.1.53367 ENSBTAP00000009371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]