SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009493 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009493
Domain Number 1 Region: 314-380
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.77e-18
Family PHD domain 0.0055
Further Details:      
 
Domain Number 2 Region: 192-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000161
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 270-329
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000648
Family PHD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009493   Gene: ENSBTAG00000007216   Transcript: ENSBTAT00000009493
Sequence length 388
Comment pep:known chromosome:UMD3.1:18:48250683:48258426:-1 gene:ENSBTAG00000007216 transcript:ENSBTAT00000009493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAIQNPLKSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKT
HRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPEGPVLEA
LLCAETGNNTPFLDPSLPSPGAQKQQLLEFPHDLEVEDPEDDMPRRKNRAKGKAYGIGGL
RKRQDTASLEDRDKPYVCDICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKN
NHKQFYKELAWVPESQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCGRS
GHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPM
AEPPEGSWSCHLCLRHLKEKASAYITLT
Download sequence
Identical sequences F1MED1
ENSBTAP00000009493 ENSBTAP00000048136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]