SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009523 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009523
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-38
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-37
Family Link domain 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009523   Gene: ENSBTAG00000007239   Transcript: ENSBTAT00000009523
Sequence length 280
Comment pep:known chromosome:UMD3.1:2:44850892:44867293:-1 gene:ENSBTAG00000007239 transcript:ENSBTAT00000009523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILIYLFVLLWEEAHGWGFKNGIFHNSIWLEQAAGVYHREARSGKYKLTYAEAKAVCEY
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIFKSPGFPNEYDDNQICYWHIRLKYGQRIHLSFLDF
DLEDDPACLADYVEVYDSYDDVHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QIKYVAVDPVSKSSQGKNASTTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences L8IL35 Q5W1C4
ENSBTAP00000009523 9913.ENSBTAP00000009523 ENSBTAP00000009523 NP_001007814.1.59421 NP_001007814.1.76553 XP_005894835.1.15283 XP_010838273.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]