SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009552 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009552
Domain Number 1 Region: 128-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 753-801
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000581
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 345-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000184
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 627-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000725
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number 5 Region: 274-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000077
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009552   Gene: ENSBTAG00000007262   Transcript: ENSBTAT00000009552
Sequence length 1300
Comment pep:known chromosome:UMD3.1:18:41116113:41214205:1 gene:ENSBTAG00000007262 transcript:ENSBTAT00000009552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEASLCLGVSSAAPEAEPHLSGPVLNGQYAMSQKLHQITSQLSHAFPELHPRPNPEEKT
PAPLDEKAHVPMSGQPMGSQMALLANQLGRDVDTSLNGRVDLQQFLNGQNLGIMSQMSDI
EDDARKNRKYPCPLCGKRFRFNSILSLHMRTHTGEKPFKCPYCDHRAAQKGNLKIHLRTH
KLGNLGKGRGRVREENRLLHELEERAILRDKQMKSSLLQPRPDLKPLAHAQQAPLAACNL
ALPTNHSLPDVANPVPSPKPASVQEDAVAPAAGFRCTFCKGKFKKREELDRHIRILHKPY
KCTLCDFAASQEEELISHVEKAHITAESAQGQGPNGGGEQSANEFRCEVCGQVFSQAWFL
KGHMRKHKDSFEHCCQICGRRFKEPWFLKNHMKVHLNKLSVKNKSPSDPEVPVPMGGMSQ
EAHANLYSRYLSCLQSGFMAADKASLSEPSQLYGKGELPLKEKEVVGKLLTPISSMAHGV
PEGDKHSLLGCLNLVPPLKSSCIERLQAAAKAAEMDPVNSYQAWQLMARGMAMEHGFLSK
EHQLQRNHEDTLANAGVLFDKEKREYVLVGADGSKQKMPADLVHSTKVGNQRDLPNKLDP
LEGSRDFLSHGLNQALEYNLQGPGSLKEKPTECPDCGRVFRTYHQVVVHSRVHKRDRKGD
EDGLHGGPDERRGSGSDQESQSVSRSTTPGSSNVTEESGVGGGLSQTGSAQEDSPHPSSP
SSSDIGEEAGRSAGVQQPALLRDRSLGSAMKDCPYCGKTFRTSHHLKVHLRIHTGEKPYK
CPHCDYAGTQSASLKYHLERHHRERQNGAGPLSGQPPSQDHRDELSNKAALFIRPDILRG
AFKGLPGIDFRGGPASQQWTSGVLSSGDHTGQASGMSSEAPSDTLKGTDLPSKSTHFSEI
GRAYQSIVNNGVNFQGSLQAFMDSFVLSSLKKEKDLKDKALSDPPSMKVHGVDGGEEKVG
GKVAPRKSEKSQYEPLDLSVRPDAASLPGSSVTVQDSIAWHGCLFCAFTTSSMELMALHL
QANHLGKAKRKDNTIGVTVNCKDQAREASKAALLPSVQSNKEMALSTMMGPLDSASEKMA
QGQVKETLGEQKGGPWPSHVDPSFCSFPSDFYKQFSVYPGLLGSGAASSCPNREPDGKAH
SEDDAPILIPETTNKNTTDDLSDIASSEDMDSSKGENNEEEDIDTEPEVMSKPPALSKDG
GGDSGDGLLPTGAPQPVQGLVSPLPQASEKQWHSPGLLPAQDPTAGLPKPERGPQGLEKP
MNVLSVLRAYSSDGLAAFNGLANSTANSGCIKRPDLCGKF
Download sequence
Identical sequences F1MW46
ENSBTAP00000009552 ENSBTAP00000009552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]