SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009703 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009703
Domain Number 1 Region: 665-957
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.69e-74
Family Protein kinases, catalytic subunit 0.00000027
Further Details:      
 
Domain Number 2 Region: 52-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000087
Family MAM domain 0.019
Further Details:      
 
Domain Number 3 Region: 13-45
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000183
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009703   Gene: ENSBTAG00000007379   Transcript: ENSBTAT00000009703
Sequence length 1191
Comment pep:known chromosome:UMD3.1:11:70519859:70646314:1 gene:ENSBTAG00000007379 transcript:ENSBTAT00000009703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAPGSSPGSKMALQSSFTCWNGTVLQLGQACDFHRDCAQGEDEGQLCRKLPAGFYCDFED
GFCGWTQSSPSPHTTQWQVRTLKDARFQDHQGHALLLSITDAPTSENATVTSATFPAPMK
NSPCELRMSWLIRGVLQGNVSLMLVENKTGKEQSRMIWRVATLEGLSLWQWTVLPLLEVA
DRFWLQIVAWWGQGSRATVAFDNISVSLDCYLTISGEDKIPQNTAPKSRNLFERNLNNEL
KPWVNPSKETPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYRNSNLSVVVGSEGPLKGIQ
TWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDTLYILVGQQGEDACP
STNRLIQKVCIGENNVIEEEIRVNKSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGG
GGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWSDNTSLLWSGKSLLEGATGGH
SCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFINPLGI
LYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKIICFCDHGTVLAEDGVSCIVS
PTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLR
TSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSP
LQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAGGDL
KSFLRETRPRPNQPSSLVMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTRPGPGR
VAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFS
LGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIE
YCTQDPDVINTALPVEYGPLVEEEEKVPMRPQDPEGIPPLLVSAAQAKREEGREPAAPAA
LPSAPPGKAGKKPAVAEACVRGGARPPAVEGGHVNMAFSQSNPPSELPQVQGSRNKPTSL
WNPTYGSWFTEKPTKKNTPPAKKEQRERGPPGGEGARAVPAPAPAARHPGASLLLEPSAL
TASLRDVPLFRLRHFPCGTVNYGYQQQGFPPEAAPGPGRYEDPAPKSQPAP
Download sequence
Identical sequences F1MUQ3
ENSBTAP00000009703 ENSBTAP00000009703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]