SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009747 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009747
Domain Number 1 Region: 172-263
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.44e-16
Family Multidomain sulfurtransferase (rhodanese) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009747   Gene: ENSBTAG00000007413   Transcript: ENSBTAT00000009747
Sequence length 373
Comment pep:known chromosome:UMD3.1:4:94959111:95006794:-1 gene:ENSBTAG00000007413 transcript:ENSBTAT00000009747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRRHIGNPEYLTRRIPQNPRYQHVKSRLDTGNSMTKYIEKLEEIKKNYRYKKDELFKR
LKVTTFAQLVIQVASLSDQTLEVTAEEIQRLEDNDSATSEPDAEITAKTNGNGSPGEQSP
SPVQFINSEGAGDFSRSTLQSVISGVGELDLDKGLVKKTEPNTKDKPYPDCPFLLLDVRD
RDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMC
ERGFENLFMLSGGLKVLAQKFPEGLITGSLPASCQQALPPGSARKRSSPKVPPLPAENKW
RFTPEDLKKIEYYLEEDQGPADNPSRLSQANASGRDAKVPGTRSGQNLPAGGPASHQNPR
SLGSGHLQGKPWK
Download sequence
Identical sequences F1MUG2 L8HZR5
ENSBTAP00000009747 NP_001179050.1.59421 NP_001179050.1.76553 XP_005905346.1.15283 XP_019814645.1.53367 ENSBTAP00000009747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]