SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009916 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009916
Domain Number 1 Region: 7-62
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000353
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 2 Region: 70-125
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000992
Family B-box zinc-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009916   Gene: ENSBTAG00000037381   Transcript: ENSBTAT00000009916
Sequence length 245
Comment pep:known chromosome:UMD3.1:23:28626339:28638869:-1 gene:ENSBTAG00000037381 transcript:ENSBTAT00000009916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLREDRQEEGICPICQECLKEAVRTDCGHLFCRACLAQHLEKASASGVRSCPLCRKPC
SEGVLGAGYTCDSPQKKAYWFCEESRRLLCMECRVTPEHKSHCELPIENAISHYKERLEG
RIKRLNRRIRRRRQLRIQEEILQEMQADHGTHRLEAELEQQPQTRRQLDAPAQQRPDQRR
DVSAELSRSPGISRALLQFSSLVTDPEGMAKKLDTSLLKDAGDLLNRLVLWLPLQGSGPK
TSVFL
Download sequence
Identical sequences E1BGL7
ENSBTAP00000009916 ENSBTAP00000009916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]