SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010141 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010141
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily SNARE-like 2.52e-41
Family Synatpobrevin N-terminal domain 0.000000352
Further Details:      
 
Domain Number 2 Region: 129-190
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000000131
Family SNARE fusion complex 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010141   Gene: ENSBTAG00000007712   Transcript: ENSBTAT00000010141
Sequence length 251
Comment pep:known chromosome:UMD3.1:3:23186298:23211710:1 gene:ENSBTAG00000007712 transcript:ENSBTAT00000010141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMT
FHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTYIQ
KTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY
RQDAKYLNMRSTYAKLAAVAVFFIMLIVSPRRCRFDPWIRKIPWRKNSCLENPINGGAWW
ATVRGVPKNGT
Download sequence
Identical sequences F1MLE8 L8IJJ3
ENSBTAP00000010141 9913.ENSBTAP00000010141 ENSBTAP00000010141 XP_005895332.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]