SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010165 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010165
Domain Number 1 Region: 552-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.99e-17
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 2 Region: 723-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000041
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 608-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000323
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 666-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000001
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 484-505,538-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000327
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 419-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000215
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000010165
Domain Number - Region: 514-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00105
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010165   Gene: ENSBTAG00000007730   Transcript: ENSBTAT00000010165
Sequence length 800
Comment pep:known chromosome:UMD3.1:X:126146067:126168149:-1 gene:ENSBTAG00000007730 transcript:ENSBTAT00000010165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDGLELQPQEPNSFFDTTGADATHMDGDQIVVEVQETVFVSDVVDSDITVHNFVPDDP
DSVVIQDVIEDVVIEDVQCPDIMEEADVSETVIIPEQVLDSDVTEEVSLAHCTVPDDVLA
SDITSASMSMPEHVLTSESIHVSDIGHVEHVVHDSVVEAEIVTDPLTADVVSEEVLVADC
ASEAVIDANGIPVDQQEDDKGNCEDYLMISLDDAGKIEHDGSSGMTMDAESEIDPCKVDG
TCPEVIKVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQNNSIRVPREKMVYMTVND
SQQEDEDLNVAEIADEVYMEVIVGEEDAAAAAAAAAAHEQQMDDNEIKTFMPIAWAAAYG
NNSDGIENRNGTASALLHIDESAGLGRLAKQKPKKRRRPDSRQYQTAIIIGPDGHPLTVY
PCMICGKKFKSRGFLKRHMKNHPEHLTKKKYRCTDCDYTTNKKISLHNHLESHKLTSKAE
KAIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKN
FPHICVECGKGFRHPSELKKHMRIHTGEKPYQCQYCEYRSADSSNLKTHVKTKHSKEMPF
KCDICLLTFSDTKEVQQHALIHQESKTHQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCD
MCDKGFHRPSELKKHVAAHKGKKMHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCKRCR
KGFRQQNELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGF
RRPSEKNQHIMRHHKEVGLP
Download sequence
Identical sequences L8I474 O62836 W5Q6P9
9913.ENSBTAP00000010165 XP_004022021.1.66739 XP_005904091.1.15283 XP_005972964.1.78601 XP_011961803.1.66739 XP_011961804.1.66739 XP_011995886.1.54773 XP_011995887.1.54773 XP_011995888.1.54773 XP_011995889.1.54773 XP_014960319.1.66739 XP_014963386.1.54773 XP_014963387.1.54773 XP_017899298.1.57651 XP_017899299.1.57651 XP_017899301.1.57651 XP_017899302.1.57651 XP_017899303.1.57651 ENSBTAP00000010165 ENSOARP00000018390 ENSBTAP00000010165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]