SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010202 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010202
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily POZ domain 3.92e-31
Family BTB/POZ domain 0.0009
Further Details:      
 
Domain Number 2 Region: 608-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000726
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010202   Gene: ENSBTAG00000007761   Transcript: ENSBTAT00000010202
Sequence length 676
Comment pep:known chromosome:UMD3.1:8:61954947:61981732:-1 gene:ENSBTAG00000007761 transcript:ENSBTAT00000010202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQ
TMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKACKHYLT
TRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALSSSQSGEEQPAPMSSSLRGNLD
QRTPFPMRRLHKRKQSAEERARQRLRPTLDESAISDVTPENGPGVHSREEFFSPDSLKIV
DNPKADGMADNPDDSTIMFDQSFSAQEDAQVPSQSDNSASNMAQLSMASRATQVETSFEQ
ETTAEKSAFQCENPEVGLGEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEGV
VVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGSNF
STNQNNDDNLPNTTSDCRLEGEAPYLLSPEAGPASGPSSAPGAHVENPFSEPSDSHFVRP
MQDVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMMGSPRGGASNFPYYRRIAPK
MPVVTSVRSSQIPENSASSQLMMNAATSSFENGLPSQPGPPQLTRASADVLSKCKKALSE
HNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSK
TTCLRWQSSNLPSTLL
Download sequence
Identical sequences A0JN94
ENSBTAP00000010202 ENSBTAP00000010202 9913.ENSBTAP00000010202 NP_001071405.1.59421 NP_001071405.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]